DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and AT1G39070

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001321704.1 Gene:AT1G39070 / 28717318 AraportID:AT1G39070 Length:1041 Species:Arabidopsis thaliana


Alignment Length:320 Identity:63/320 - (19%)
Similarity:112/320 - (35%) Gaps:79/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LIISELTVVNPGAEVKSKIGEPVTYENAAKQDLAPK------PAVTSNSKPIAKKEP-------S 148
            |:||::..:....:.|:....|:..||..|..|..:      |.:.:.|..:...:.       .
plant   720 LMISQMHWILTHFDHKNTNKSPLLGENRRKWPLLGEIGYKCCPNIPNLSLSLIISQMHWIVTHFD 784

  Fly   149 HNNNNNIVMN------SSINSGMTHPISSLSPYQNKWVIKARVTSKSGIRT--WSNARGEGKLFS 205
            |.|.|....|      ::.|..:|..|:|   ::.||.:..:...|..:.|  .|..|..|....
plant   785 HRNTNKTGENGYKCCLNTPNPSLTLIITS---FERKWPLLGQNGYKCCLNTPNPSLTRENGYKCC 846

  Fly   206 MDLMDESGEIRATAFKEQCDKF-----YDL---------IQVDSVYYI----------------S 240
            ::..:.|..:..|.|||:...|     |.|         :.:..:::|                .
plant   847 LNTPNPSLTLIITYFKEKIASFGRKWVYVLSKHSNPSLTLIISQMHWIVTHFDHKNTNKTRENGY 911

  Fly   241 KCQLKPANKQYSSLNNAY--EMTFSGETVVQLCEDTDDDPIPEIK--------------YNLVPI 289
            ||.|...|...:....::  :....||...:.|.:|.:..:..||              .|..|:
plant   912 KCCLNTPNPSLTLRITSFGTKRPLLGENGYKYCLNTPNPSLTLIKCQMHWIVTHCDHKNTNKTPL 976

  Fly   290 SDVSGMENK---AAVDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWG 346
            ..    ||.   ..:|.:|...:...:|...|  .||..||.|..|.|.:::.::..|||
plant   977 LG----ENSLFWEKMDAMGQVVDQSGIQDLNA--NNKPTKKIDFHLRDQNDTRLACILWG 1030

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 63/320 (20%)
Rep-A_N 6..107 CDD:281980 3/9 (33%)
RPA1_DBD_A 168..270 CDD:239920 24/135 (18%)
RPA1_DBD_B 301..401 CDD:239921 14/46 (30%)
Rep_fac-A_C 444..589 CDD:285809
AT1G39070NP_001321704.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189265at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.