DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and MEIOB

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001157032.1 Gene:MEIOB / 254528 HGNCID:28569 Length:471 Species:Homo sapiens


Alignment Length:389 Identity:82/389 - (21%)
Similarity:154/389 - (39%) Gaps:57/389 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 TSKSGIRTWSNARGEGKLFSMDLMDESGE-IRATAF------KEQCDKFY--DLIQVDSVYYISK 241
            |...|.....|...|...||..:.|.... :.|.::      |...|.|.  |.:.:::. .|.:
Human    33 TDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASWGNEDYIKSLSDSFRVGDCVIIENP-LIQR 96

  Fly   242 CQLKPANK-QYSSLNNAYEMTFSGETVVQLCEDTDDD---------PIPEIK--YNLVPISDVSG 294
            .:::...| ..::.:|...:.....:.|::|...:.|         |:.|..  |:|..|.....
Human    97 KEIEREEKFSPATPSNCKLLLSENHSTVKVCSSYEVDTKLLSLIHLPVKESHDYYSLGDIVANGH 161

  Fly   295 MENKAAVDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWGDDAVNFDGHVQP- 358
            ..|...::.:...|.|||.:.|.. :..::.::.::.|.|.:.|:.::|.|.::::.......| 
Human   162 SLNGRIINVLAAVKSVGEPKYFTT-SDRRKGQRCEVRLYDETESSFAMTCWDNESILLAQSWMPR 225

  Fly   359 --VILVKGTRIN--EFNGGKSLSLGGGSIMKINPDIPEAHKLRGWFDNGGGDSVAN--------- 410
              ||.....|||  :|....:.::...:|:..|||||||:.|..:.......:|.:         
Human   226 ETVIFASDVRINFDKFRNCMTATVISKTIITTNPDIPEANILLNFIRENKETNVLDDEIDSYFKE 290

  Fly   411 MVSARTGGGSFSTEWMTLKDARARNLGSGDKPDYFQCKAVVHIVKQENAFYRA----CPQSDCNK 471
            .::..|....::.|  .||....:|.|..| |.|....|.:..:..::...:.    |  |.|. 
Human   291 SINLSTIVDVYTVE--QLKGKALKNEGKAD-PSYGILYAYISTLNIDDETTKVVRNRC--SSCG- 349

  Fly   472 KVVDEGNDQFRCEKCNALFPNFK-----YRLLINMSIGDWTSNRWVSSF-NEVGEQLLGHTSQE 529
            .:|:|.::.  |..||....:||     :.:||:::  |.|......|. ..|.|:.||.|..|
Human   350 YIVNEASNM--CTTCNKNSLDFKSVFLSFHVLIDLT--DHTGTLHSCSLTGSVAEETLGCTVHE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 82/389 (21%)
Rep-A_N 6..107 CDD:281980
RPA1_DBD_A 168..270 CDD:239920 16/93 (17%)
RPA1_DBD_B 301..401 CDD:239921 26/104 (25%)
Rep_fac-A_C 444..589 CDD:285809 23/96 (24%)
MEIOBNP_001157032.1 RPA1_DBD_B 167..270 CDD:239921 26/103 (25%)
RPA_2b-aaRSs_OBF_like <345..>421 CDD:299125 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.