DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and R03H10.7

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_494734.3 Gene:R03H10.7 / 187559 WormBaseID:WBGene00019859 Length:359 Species:Caenorhabditis elegans


Alignment Length:243 Identity:66/243 - (27%)
Similarity:115/243 - (47%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PISSLSPYQNKWVIKARVTSKSGIRTWSNARGEGKLFSMDLMDESGE-IRATAFKEQCDKFYDLI 231
            ||.:|....|.:.|..|||    :..........|.|:.::.|.:|: |..:|...:.|.||..:
 Worm   116 PIENLKESVNYFKIHGRVT----LMDTRPPHHYQKRFNFEITDFNGDTIACSASSPEADVFYQNL 176

  Fly   232 QVDSVYYISKCQLKPANKQYSSLNNAYEMTFSGETVVQLCEDTDDDPIPEI----KYNL--VPIS 290
            ..:..||::...:|..::.|:.....|::..:..|::        :|.|.:    |:|:  |.:|
 Worm   177 VKEQSYYLAGGHIKKGHEIYNQTGIDYQIDLNNFTIM--------EPAPTLLTLPKFNIQRVFLS 233

  Fly   291 DVSGMENKAAVDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWGDDAVNF--D 353
            ||:.:  |..:|.:...||..:::::.. |.||...||.|.::|.|.|.|..|.||.:||:.  :
 Worm   234 DVANV--KKPIDVLVCIKEFKDVENYTP-TENKPPHKRHIQVIDDSKSEIRATFWGYNAVDAIRE 295

  Fly   354 GHVQPVILVKGTRINEFNGGKSLSLGGGSIMKINPDIPEAHKLRGWFD 401
            ..:..|:..||....|.||...||:..|:.:.|.|::..|..|..|||
 Worm   296 EFLNKVVAFKGVIPTEGNGQLFLSITPGTRIVIQPEVDGAAYLEAWFD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 66/243 (27%)
Rep-A_N 6..107 CDD:281980
RPA1_DBD_A 168..270 CDD:239920 23/102 (23%)
RPA1_DBD_B 301..401 CDD:239921 32/101 (32%)
Rep_fac-A_C 444..589 CDD:285809
R03H10.7NP_494734.3 RPA_2b-aaRSs_OBF_like 7..101 CDD:385638
rpa1 <106..>355 CDD:273177 66/243 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189265at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.