DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtg and CG13643

DIOPT Version :10

Sequence 1:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster


Alignment Length:165 Identity:46/165 - (27%)
Similarity:70/165 - (42%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 DLPPTSFSCAKQKHFPGLYADTDLGCMVFHVCA-LTDDGMVRK------------SFLCPENTLF 444
            ::|.|.|:| ..|...|.|||.:..|.:||||. |...|::.:            .||||..|.|
  Fly    48 NMPKTQFTC-HDKILGGYYADPETQCQMFHVCVKLPGVGLLHRRANPFVQQVQDYRFLCPNTTAF 111

  Fly   445 DQTILKCNWWFYVDCSSSTSVYDSNIPISKSYQLMKSLTYFSKYAGGQRHEQGGDKDENALDIDS 509
            ||.:..|..|..|||..:||.|| |..::..|                   :.||:.::|     
  Fly   112 DQELQICANWLDVDCDKATSFYD-NGHLNDLY-------------------RNGDESKSA----- 151

  Fly   510 LRESMEGVARRQEQAKKAELRVEEQRSMPKEDHEH 544
               :.|......::|:..::|    ||  ||:|.:
  Fly   152 ---NEEEATFHLQRAETGDIR----RS--KENHNN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtgNP_731221.2 CBM_14 409..459 CDD:426342 22/62 (35%)
CG13643NP_001262937.1 CBM_14 63..126 CDD:426342 22/62 (35%)
Herpes_BLLF1 <296..595 CDD:282904
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.