DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtg and CG14607

DIOPT Version :10

Sequence 1:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:104 Identity:40/104 - (38%)
Similarity:51/104 - (49%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 SKVMNAPKEYYPVGYDKNFDDNFKSKVDLPPTSFSCAKQKHFPGLYADTDLGCMVFHVCALTDDG 430
            |.:...|...||:            ...:|.|:|.||:|. .||.|||.:..|.|||:|||..  
  Fly   167 SAIPGVPGVDYPI------------YAQVPRTNFDCAQQP-LPGYYADIEAQCQVFHICALNR-- 216

  Fly   431 MVRKSFLCPENTLFDQTILKCNWWFYVDCSSSTSVYDSN 469
              ..|||||..|:|.|..|.|.||...||.|:.|:|.:|
  Fly   217 --TYSFLCPNGTVFSQETLVCVWWNQYDCVSAPSLYANN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtgNP_731221.2 CBM_14 409..459 CDD:426342 23/49 (47%)
CG14607NP_649709.2 PRK04654 <40..137 CDD:135173
CBM_14 190..243 CDD:426342 27/57 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.