DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtg and CG5756

DIOPT Version :10

Sequence 1:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_611292.2 Gene:CG5756 / 37064 FlyBaseID:FBgn0034301 Length:1220 Species:Drosophila melanogaster


Alignment Length:136 Identity:40/136 - (29%)
Similarity:60/136 - (44%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 GYDKNFDDNFKS------KVDL------------------PPTSFSCAKQKHFPGLYADTDLGCM 419
            |..::|:|..||      :.||                  |.|||.| |.:| .|.|||.:..|.
  Fly    24 GSREHFEDADKSSEYTDQQFDLRHTIPGEPGLDYPILSSPPRTSFVC-KGRH-EGYYADVESRCQ 86

  Fly   420 VFHVCALTDDGMVRKSFLCPENTLFDQTILKCNWWFYVDCSSSTSVYDSN--IPISKSYQLMKSL 482
            .|.:||.|........||||..|||.|....|:|:..|:|..|...|:.|  ..:..::::|:.:
  Fly    87 AFRICAHTARSPQGFGFLCPNGTLFSQKNFVCDWYRNVNCDDSEKYYEMNEEKTVGSTHEMMERV 151

  Fly   483 TYFSKY 488
            .:..:|
  Fly   152 RHMMEY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtgNP_731221.2 CBM_14 409..459 CDD:426342 20/49 (41%)
CG5756NP_611292.2 CBM_14 70..126 CDD:426342 23/57 (40%)

Return to query results.
Submit another query.