DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAFG and maf-S

DIOPT Version :9

Sequence 1:NP_002350.1 Gene:MAFG / 4097 HGNCID:6781 Length:162 Species:Homo sapiens
Sequence 2:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster


Alignment Length:97 Identity:52/97 - (53%)
Similarity:78/97 - (80%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    24 LTDEELVTMSVRELNQHL--RGLSKEEIVQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAEL 86
            :||::||::|||:||:.|  |||::||||::|||||||||||||||||:||:.||:|||.:|:..
  Fly    27 ITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYE 91

Human    87 QQEVEKLASENASMKLELDALRSKYEALQTFA 118
            ..|:|::..:|..::.|:...::||:||..||
  Fly    92 WTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAFGNP_002350.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 52/97 (54%)
bZIP_Maf_small 46..115 CDD:269865 36/68 (53%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 53..76 19/22 (86%)
coiled coil 54..105 CDD:269865 28/50 (56%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..93 5/13 (38%)
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 36/68 (53%)
coiled coil 59..110 CDD:269865 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143691
Domainoid 1 1.000 102 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4930
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm41661
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.