DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9636 and CUEDC2

DIOPT Version :9

Sequence 1:NP_649774.1 Gene:CG9636 / 40967 FlyBaseID:FBgn0037556 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_076945.2 Gene:CUEDC2 / 79004 HGNCID:28352 Length:287 Species:Homo sapiens


Alignment Length:299 Identity:81/299 - (27%)
Similarity:153/299 - (51%) Gaps:28/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MVKRSLVQFISGHIPGADFSVVDEIVLSYIISILEE----ASQDPCFDVEGFVEMMGAYFEEFST 70
            :|..:|:.|:..|:|.||.|.:||::.||::.:||:    ...:..||:|.|.|||.||...|:.
Human     6 IVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAH 70

  Fly    71 IDQGIICDWIYKLANELTDMEKTQENPDAVNLSLNSLSLSSIIPESKLRARNSSTSEKDELSSNS 135
            |.:|.|.|.:.||:.:|:|....:      ||...|..:...:|.|....:.....:::..||.:
Human    71 IPRGTIGDMMQKLSGQLSDARNKE------NLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAA 129

  Fly   136 SSSGGCGGNKRSQHLSETSDGGSTDSSSSTCDYFLDETEVLQEMFPDSAIAEIKHCIAISKGDID 200
            :::                  .:.|.::...:..|...:||.|:||..::.:.:..:|.::||::
Human   130 AAA------------------DTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLE 176

  Fly   201 SATQILLHRQETNQCITDKSHTTYMKKNVIVDDNELKNRIIARYSYVDKNATQREYKPVVPKMEP 265
            .|.|:|:..:|......:..:....::......:|||:.|:.:|..||....|:.::|:.||..|
Human   177 EAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAP 241

  Fly   266 RKLVRYRDNKIVSLKGERYTEIKRDEDAELKKPKKQIQP 304
            :||:||.||::||.||||:.:::..|..|:|.....::|
Human   242 KKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9636NP_649774.1 CUE_CUED2 169..210 CDD:270550 12/40 (30%)
CUEDC2NP_076945.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..141 8/72 (11%)
CUE_CUED2 147..186 CDD:270550 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154184
Domainoid 1 1.000 67 1.000 Domainoid score I9851
eggNOG 1 0.900 - - E1_2BVVF
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11430
Inparanoid 1 1.050 136 1.000 Inparanoid score I4565
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47001
OrthoDB 1 1.010 - - D1410219at2759
OrthoFinder 1 1.000 - - FOG0008394
OrthoInspector 1 1.000 - - oto89043
orthoMCL 1 0.900 - - OOG6_109461
Panther 1 1.100 - - LDO PTHR12493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5269
SonicParanoid 1 1.000 - - X6383
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.