DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9636 and cuedc2

DIOPT Version :9

Sequence 1:NP_649774.1 Gene:CG9636 / 40967 FlyBaseID:FBgn0037556 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_017950751.1 Gene:cuedc2 / 100145279 XenbaseID:XB-GENE-1015746 Length:274 Species:Xenopus tropicalis


Alignment Length:315 Identity:84/315 - (26%)
Similarity:155/315 - (49%) Gaps:71/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EMVKRSLVQFISGHIPGADFSVVDEIVLSYIISILEEA----SQDPCFDVEGFVEMMGAYFEEFS 69
            ::::.||..||..|||.:|.|.:||:..:|:..:|||.    |.:..|::|.||||:..|...||
 Frog     5 KIIRESLTGFIQCHIPHSDLSALDEVFYAYVSGVLEELGSQYSSEEDFEMESFVEMLEGYIPGFS 69

  Fly    70 TIDQGIICDWIYKLANELTDMEKTQEN--PDAVNLSLNSLSLSSIIPESKLRARNSSTSEKDELS 132
            .|..|.:.|.:::|:..|::....:||  |..      ::.:..:.|.       |.::|..|.:
 Frog    70 EISSGKVYDMLFELSGRLSEARGKEENVSPKP------TVEVLFVTPA-------SPSTESSEKT 121

  Fly   133 SNSSSSGGCGGNKRSQHLSETSDGGSTDSSSSTCDYFLDETEVLQEMFPDSAIAEIKHCIAISKG 197
            :..|..|....:|                     |...::.::|.|:||...:::.:..::::||
 Frog   122 TTESLEGAVAQDK---------------------DDPKNDVDLLLEIFPSCTVSQAQTALSMAKG 165

  Fly   198 DIDSATQILLHRQETNQCITDKSHTTYMKKNVIVDDN-------------ELKNRIIARYSYVDK 249
            |::.|.|:::..:                  |:||::             :||:.|:.:|..||.
 Frog   166 DLEDAVQVIVDGK------------------VMVDNHSGSKDLQGAPKVEDLKDFILQKYMLVDT 212

  Fly   250 NATQREYKPVVPKMEPRKLVRYRDNKIVSLKGERYTEIKRDEDAELKKPKKQIQP 304
            :..::.|:||.||..|:|::||.||::||.|||||.:||:.|..|:||....::|
 Frog   213 DDDKKTYRPVAPKEAPKKMIRYIDNQVVSTKGERYKDIKKPESEEMKKTYINLKP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9636NP_649774.1 CUE_CUED2 169..210 CDD:270550 9/40 (23%)
cuedc2XP_017950751.1 CUE_CUED2 137..178 CDD:270550 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11430
Inparanoid 1 1.050 131 1.000 Inparanoid score I4501
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1410219at2759
OrthoFinder 1 1.000 - - FOG0008394
OrthoInspector 1 1.000 - - oto102905
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5269
SonicParanoid 1 1.000 - - X6383
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.