DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada2b and YOR338W

DIOPT Version :9

Sequence 1:NP_001027151.1 Gene:Ada2b / 40966 FlyBaseID:FBgn0037555 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_014983.1 Gene:YOR338W / 854516 SGDID:S000005865 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:62/293 - (21%)
Similarity:101/293 - (34%) Gaps:75/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 QLGYMPN---------RDSFEREYDPTAEQLISNISLSSEDTEVDVMLKLAHVD---IYTRRLRE 221
            ::||..|         |::.|...: :.|.....||.||....:|     |.:|   |.:..|..
Yeast    29 KIGYKLNQQVQRLAVVRNNIEERLN-SMESSHGQISDSSVVRAID-----ASIDDFLIPSPPLSP 87

  Fly   222 RARRKRMVRDYQLVSNFFRNRNYAQ-----QQGLTKEQ-----REFRDRFRVYAQFYTC----NE 272
            :.|:..::...|||:....:|....     :.||..::     |.|..::..:....|.    |:
Yeast    88 KLRQCPIISQPQLVNVESDHRELIMLTPVWEAGLNSQKYNHNTRNFLSQYSFFRDMKTTKRIPNK 152

  Fly   273 YERLLGSLER-------------EKELRIRQSELYRYRYNGLTKIAECTHFEQHAATATHRSTGP 324
            ..|.|..::.             :::::.|..|||....|     ....:.|:.|.....||..|
Yeast   153 ENRKLKVVKSVVNSEALPKRRRYDRKIKRRSRELYEDDGN-----RSENYDEESAQEVPVRSVTP 212

  Fly   325 YGHGKTD-HTHTS--------NG--------------SHRPPSSSLHSPQPNLRKVEMSSGGEAS 366
            ....|.. ||.:|        |.              .:.||..:|.:....:.|||. .|....
Yeast   213 IRQVKRSLHTISSPLASQGVVNNVPKYIPSMSWEKLPDYSPPLHTLPNSNNKVLKVEW-KGSPMD 276

  Fly   367 SNSIAPRNTLHIADPTCSGAL-LPSKNYLDSCR 398
            .|....:..||.|:...:..| ||...||||.|
Yeast   277 LNHDPLKQRLHPAELVLAQILRLPCDLYLDSKR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada2bNP_001027151.1 COG5114 10..>341 CDD:227445 43/233 (18%)
ZZ_ADA2 11..58 CDD:239075
SANT 73..115 CDD:238096
YOR338WNP_014983.1 SWIRM 285..354 CDD:398234 11/25 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12374
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.