DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada2b and FUN19

DIOPT Version :9

Sequence 1:NP_001027151.1 Gene:Ada2b / 40966 FlyBaseID:FBgn0037555 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_009368.2 Gene:FUN19 / 851199 SGDID:S000002134 Length:413 Species:Saccharomyces cerevisiae


Alignment Length:367 Identity:73/367 - (19%)
Similarity:121/367 - (32%) Gaps:113/367 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 QSQRPRL-IDHTGDDDAGPLGTNALSTLPPLEINSD---EAMQLGYMPNRDSFEREYDPTAEQLI 191
            :|::.:| :::.|.||:..:.......|.....|:|   ..:.:....|...:.|.||....|..
Yeast     7 ESEKSQLNMNYIGKDDSQSIFRRLNQNLKASNNNNDSNKNGLNMSDYSNNSPYGRSYDVRINQNS 71

  Fly   192 SN----ISLSSEDTEVDVML------------KLAHVDIYTRRLRER----ARRKRMVRDYQLVS 236
            .|    ....|.|:.||..:            |::|..  :.|:...    :..|..|.:...|.
Yeast    72 QNNGNGCFSGSIDSLVDEHIIPSPPLSPKLESKISHNG--SPRMASSVLVGSTPKGAVENVLFVK 134

  Fly   237 NFFRNRNYAQQQGLTKEQRE-----FRDRFRVY---AQFYT---CNEYERL-------------- 276
            ..:.|       ||::::..     |..:::::   ||.|:   .|.|..|              
Yeast   135 PVWPN-------GLSRKRYRYATYGFLSQYKIFSNLAQPYSKNIINRYNNLAYNARHKYSKYNDD 192

  Fly   277 ----------------LGS--LEREKELRIRQSELYRYRYNGLTKIAECTHF-----------EQ 312
                            |.|  |.|:....:|:..||.   |.|.|....|.:           .:
Yeast   193 MTPPPLPSSSSRLPSPLASPNLNRQARYNMRKQALYN---NNLGKFESDTEWIPRKRKVYSPQRR 254

  Fly   313 HAATATHRSTGPYGHGKTDHTHTSN-------------------GSHRPPSSSLHSPQPNLRKVE 358
            ...|:.||:........|.||:.::                   ..:.||.|:|.:......|:|
Yeast   255 TMTTSPHRAKKFSPSASTPHTNIASIEAIHDAPQYIPNVSWKKLPDYSPPLSTLPTDSNKSLKIE 319

  Fly   359 MSSGGEASSNSIAP-RNTLHIADPTCSGAL-LPSKNYLDSCR 398
            ..  |.....|..| ||.||.|:...:..| ||...||||.|
Yeast   320 WK--GSPMDLSTDPLRNELHPAELVLAQTLRLPCDLYLDSKR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada2bNP_001027151.1 COG5114 10..>341 CDD:227445 51/306 (17%)
ZZ_ADA2 11..58 CDD:239075
SANT 73..115 CDD:238096
FUN19NP_009368.2 SWIRM 331..409 CDD:398234 14/29 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12374
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.