DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada2b and ADA2B

DIOPT Version :9

Sequence 1:NP_001027151.1 Gene:Ada2b / 40966 FlyBaseID:FBgn0037555 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_567495.1 Gene:ADA2B / 827336 AraportID:AT4G16420 Length:487 Species:Arabidopsis thaliana


Alignment Length:392 Identity:111/392 - (28%)
Similarity:172/392 - (43%) Gaps:85/392 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYNCTNCQDDIQG-IRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDTGTSILSVFRGKGA 73
            ||||..||.||.| ||:.||.|.:||||::|.:.||||..|:.:|.|:.|...|..|..    ..
plant    44 KYNCDYCQKDITGKIRIKCAVCPDFDLCIECMSVGAEITPHKCDHPYRVMGNLTFPLIC----PD 104

  Fly    74 WTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNGTI---------------- 122
            |:|.:|:.||:.:|.||.|||.::::|:.|||.|...|.|.|.::|...                
plant   105 WSADDEMLLLEGLEIYGLGNWAEVAEHVGTKSKEQCLEHYRNIYLNSPFFPLPDMSHVAGKNRKE 169

  Fly   123 ------GRATWTPAQ------------------SQRPRLIDHTGDDDAGPLGTNALSTLPPLEIN 163
                  ||.....|:                  :|:...:|.:..      |...:||    .:|
plant   170 LQAMAKGRIDDKKAEQNMKEEYPFSPPKVKVEDTQKESFVDRSFG------GKKPVST----SVN 224

  Fly   164 SDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRM 228
            :.......|...|:.|:.|||..||||::.:.....||..:..|||..:.||::||.||.|||..
plant   225 NSLVELSNYNQKREEFDPEYDNDAEQLLAEMEFKENDTPEEHELKLRVLRIYSKRLDERKRRKEF 289

  Fly   229 VRDYQLVSNFFRNRNYAQ--QQGLTKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQS 291
            :.:        ||..|..  ::.|::|::....|..|:.:|::..|::.||.::..|..:..|..
plant   290 IIE--------RNLLYPNPFEKDLSQEEKVQCRRLDVFMRFHSKEEHDELLRNVVSEYRMVKRLK 346

  Fly   292 ELYRYRYNGLTKIAECTHF-------EQHAATATHRSTGPYGH--GKTDHTHTSNGSHRPP---S 344
            :|...:..|....||...:       |........:.:|.:|.  |:.       || |||   |
plant   347 DLKEAQVAGCRSTAEAERYLGRKRKRENEEGMNRGKESGQFGQIAGEM-------GS-RPPVQAS 403

  Fly   345 SS 346
            ||
plant   404 SS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada2bNP_001027151.1 COG5114 10..>341 CDD:227445 105/382 (27%)
ZZ_ADA2 11..58 CDD:239075 25/47 (53%)
SANT 73..115 CDD:238096 18/41 (44%)
ADA2BNP_567495.1 COG5114 41..483 CDD:227445 111/392 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4548
eggNOG 1 0.900 - - E1_COG5114
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1626
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D812864at2759
OrthoFinder 1 1.000 - - FOG0001650
OrthoInspector 1 1.000 - - otm3576
orthoMCL 1 0.900 - - OOG6_100940
Panther 1 1.100 - - O PTHR12374
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.