powered by:
Protein Alignment Ada2b and sqst-5
DIOPT Version :9
Sequence 1: | NP_001027151.1 |
Gene: | Ada2b / 40966 |
FlyBaseID: | FBgn0037555 |
Length: | 555 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497158.3 |
Gene: | sqst-5 / 28661656 |
WormBaseID: | WBGene00269434 |
Length: | 192 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 15/63 - (23%) |
Similarity: | 28/63 - (44%) |
Gaps: | 5/63 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TIADLFTKYNCTNCQDDIQ-GIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDTGTSI 64
|:...:..::|..|:.:.. ..|..|..|.::|||.||.|. ..|.|:...:.:.:.|.:
Worm 116 TLLPTYHPFDCDECKAECNWNNRYKCTICADYDLCRQCEAK----NLHANHAMLRILSSDTEL 174
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D812864at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.