DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada2b and sqst-5

DIOPT Version :9

Sequence 1:NP_001027151.1 Gene:Ada2b / 40966 FlyBaseID:FBgn0037555 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_497158.3 Gene:sqst-5 / 28661656 WormBaseID:WBGene00269434 Length:192 Species:Caenorhabditis elegans


Alignment Length:63 Identity:15/63 - (23%)
Similarity:28/63 - (44%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TIADLFTKYNCTNCQDDIQ-GIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDTGTSI 64
            |:...:..::|..|:.:.. ..|..|..|.::|||.||.|.    ..|.|:...:.:.:.|.:
 Worm   116 TLLPTYHPFDCDECKAECNWNNRYKCTICADYDLCRQCEAK----NLHANHAMLRILSSDTEL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada2bNP_001027151.1 COG5114 10..>341 CDD:227445 14/56 (25%)
ZZ_ADA2 11..58 CDD:239075 13/47 (28%)
SANT 73..115 CDD:238096
sqst-5NP_497158.3 ZZ_NBR1_like 126..167 CDD:239080 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D812864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.