DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada2b and laf2

DIOPT Version :9

Sequence 1:NP_001027151.1 Gene:Ada2b / 40966 FlyBaseID:FBgn0037555 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_587806.1 Gene:laf2 / 2538956 PomBaseID:SPCC1682.13 Length:272 Species:Schizosaccharomyces pombe


Alignment Length:168 Identity:36/168 - (21%)
Similarity:56/168 - (33%) Gaps:44/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 SSGGEASSNSIAPRNTLHIADPTCSGALLPSKNYLDSCRGSSAATMLQTTGMVMGVTVDSGATTG 424
            ||.|....:|::.|:    :.|:.||||..::..:.|...:..|...:           |....|
pombe    99 SSSGSRGRSSVSSRD----SSPSYSGALRSAERSISSSPSTIEARRRK-----------SARGNG 148

  Fly   425 VTSTATTMANLPTNSAKGSQQHLQPL--QQHPQLLQSGNQHKMQNEAAGGGSDQVPSMSLKLRTQ 487
            :.. |..:||||..........:..|  :.||:.|::        |..|...|            
pombe   149 LNG-AIDVANLPFEELPNFCPDMSVLDNRTHPRTLKA--------EWKGPPLD------------ 192

  Fly   488 LEELKHLPQPPGSELLSHNELDLCKKHNITPTTYLSVK 525
                  |...|..:||...||.|.....:....||..|
pombe   193 ------LSDDPYRDLLHPAELHLASTLRLPCLIYLDNK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada2bNP_001027151.1 COG5114 10..>341 CDD:227445
ZZ_ADA2 11..58 CDD:239075
SANT 73..115 CDD:238096
laf2NP_587806.1 SWIRM 191..271 CDD:282311 11/52 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12374
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.