DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNApol-iota and F08F8.4

DIOPT Version :9

Sequence 1:NP_001287227.1 Gene:DNApol-iota / 40965 FlyBaseID:FBgn0037554 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_498625.1 Gene:F08F8.4 / 176046 WormBaseID:WBGene00017269 Length:314 Species:Caenorhabditis elegans


Alignment Length:115 Identity:23/115 - (20%)
Similarity:45/115 - (39%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 RDTSLVRPSGKPKTIGMEDACKPI-----------SVRTDVEERFRMLLKRLVEQVAEDGRVPIA 329
            :|..|  |....|...::|..|.:           |...||::..|...:::::..|.|..: ||
 Worm     2 KDPGL--PKNSLKKSKLDDYFKKVERNTEENLQEQSTSADVQKSLRCPKRKVLDDDATDDNI-IA 63

  Fly   330 IKVVLRKFDSQKKSSHRETKQANILPSLFKTSM---CPGETGVSKVQLAD 376
            .|         :|.:.|:....:.:..|.|:.|   | |::.:...:..|
 Worm    64 KK---------EKRAVRKRSSGHSMKKLAKSQMVLDC-GQSVIGSTKCKD 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNApol-iotaNP_001287227.1 PolY_Pol_iota 18..411 CDD:176457 23/115 (20%)
F08F8.4NP_498625.1 zf-C2H2_3 86..125 CDD:290589 4/19 (21%)
NAT_SF 239..299 CDD:302625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4551
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.