DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNApol-iota and esco1

DIOPT Version :9

Sequence 1:NP_001287227.1 Gene:DNApol-iota / 40965 FlyBaseID:FBgn0037554 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_005174247.1 Gene:esco1 / 100333282 ZFINID:ZDB-GENE-130530-818 Length:933 Species:Danio rerio


Alignment Length:487 Identity:97/487 - (19%)
Similarity:158/487 - (32%) Gaps:151/487 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 VRPSGKPKTIGMEDACKPI---SVRT-------DVEERFRMLLKRLVEQVA--EDGRVPIAIKVV 333
            |...|..|.:......|||   :::|       .:|..:..|.....|::.  :..::.:|.|..
Zfish   103 VLKKGNKKYVSRVKREKPIISETIKTVAAMFPVQIEHNYGRLFDMQAEEITLPKPDKIHVANKSE 167

  Fly   334 LRKFDSQKKSSHRETKQANILPSLFKTSMCPGETGVSKVQLA-DGAQDKLLKI---VMRLFERIV 394
            ::.....:.|...|.|:.:..|             |.|:.:: |...|.:.|.   :..|| :::
Zfish   168 MQALHETQASKAEEQKELHAEP-------------VEKITVSVDAKVDVMSKSPPPLEALF-KVI 218

  Fly   395 DMSKPFNITLLGLAFSKFQERK----------VGSSSIANFLIKKADLEVQSITSLTNTSLTSPT 449
            ..|.....:..|...|...|.:          |.|:.:|...::.:|..:.....:.|..:...|
Zfish   219 QESSLTKHSFSGKDISDMDELEVVNTCSLQDSVQSTDVAKVFLQDSDAFLDDDVEIENCVVEIET 283

  Fly   450 AESPTSD----------ECA----FRSSPTTFK----------PSDQFYRRRATTASPVPMLLDN 490
            .|....|          ||.    ..|||:..:          |..|....:|.|.:.:..|.:.
Zfish   284 YEDLDGDQGEVSKKQTSECVTCKEVNSSPSLPQESATDSSQELPKKQAMNPQARTKARLAALAEE 348

  Fly   491 -------------------------------GSESAATNS------DFSDFSE-TEVEPSPKKSR 517
                                           |:....||.      :..|.|| |||..|...|.
Zfish   349 RAAAAKKPPPRHFNLLALCEEIADDIASDAPGASDKTTNEQQQEDHESEDVSECTEVSESKDASE 413

  Fly   518 IGRLLVSKRSRLAADVGDSAAEVASPSKLRVCDLRLNSRDSEKDF--PMST---------TPSTS 571
                  ||....:.|:.:|  :.||.||    |:..|...||.:.  |...         ||:..
Zfish   414 ------SKEVNESKDLSES--KDASESK----DVSENKEVSETETCEPEEVVSENTAPPGTPNEE 466

  Fly   572 TSAPAP-------RFRTVQ---PPNT----------LLQRIDGSLRFVTTRTASRLSSNASSTAS 616
            |:.|.|       ||...|   |..|          .|::::.....:|.....:|.|:..:.|.
Zfish   467 TADPRPEDGTPKKRFFLSQMSVPLKTQEKKKLSRFQRLRQVELQRDKLTWTRVKKLKSDQVNQAG 531

  Fly   617 SPLPSPMDDSIAMS-APSTTTLPFPSPTTTAV 647
            |     ..||.|.| :||..|.|...|||.:|
Zfish   532 S-----QKDSEASSVSPSPATTPAQVPTTESV 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNApol-iotaNP_001287227.1 PolY_Pol_iota 18..411 CDD:176457 25/145 (17%)
esco1XP_005174247.1 zf-C2H2_3 703..737 CDD:290589
Acetyltransf_13 856..918 CDD:290591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4551
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.