DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18249 and Tollo

DIOPT Version :9

Sequence 1:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:472 Identity:120/472 - (25%)
Similarity:213/472 - (45%) Gaps:85/472 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICGLTVSDALAVYDASGRFNLSASCPDSFCSLSDRPVAYSATPALQLRELHLRNCSRQSITWLVL 75
            :||.|    |...|.|.  |...|.|.:..|...|..             || |.::.|:::|..
  Fly   207 VCGST----LQSLDLSA--NKMVSLPTAMLSALGRLT-------------HL-NMAKNSMSFLAD 251

  Fly    76 QLTPGLRTLVIRNCATYHISKESLRP-----VENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLS 135
            :...||.:|.:.:.:...::  ||.|     .:.|..:.::..|:.||...||..:..|.:|.|:
  Fly   252 RAFEGLLSLRVVDLSANRLT--SLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLA 314

  Fly   136 QNFIHT--VHVAAFQGLSKLRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIFAKN 198
            .|.:::  ::.|.|.||.:|.:|.|..|.|:.:.:....||..|..|.|..|.:..||..|||..
  Fly   315 SNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADL 379

  Fly   199 KKLQTLLLNGNPLRILMPDVLGSLPNLRL--LDLGHAAELEVMTL-NLTNVQNLVLEGSSLSSL- 259
            ..|.||:|:.|.:.::....|..|.||.:  ||....:.::..:| |.:.:|:|.|..:.|.:: 
  Fly   380 TNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVP 444

  Fly   260 --VINGGFIK-LQAGNNELNHLQVGNKSSVIEMD-LHGNLLNGNDTAALLRG----MWNLQRLDL 316
              :.:...:| |..|.|.::.::   .:|:.::: |:|..:..|....:.||    |.:||.|:|
  Fly   445 EALAHVQLLKTLDVGENMISQIE---NTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNL 506

  Fly   317 SKNRIEALP----QHGSGLDA---SGTQELLI------LPSLKFLNLANNQLVR-----LPPESP 363
            |:|:::::.    |..|.|.|   .|.|...|      ||:|.:||::.|:|.:     :|....
  Fly   507 SQNKLKSIEAGSLQRNSQLQAIRLDGNQLKSIAGLFTELPNLVWLNISGNRLEKFDYSHIPIGLQ 571

  Fly   364 ILSSR------------------LSYLDLSHNLMLTLDV-AILRSLSVLKGLYVEGNRLNTINYQ 409
            .|..|                  ||..|.|:||:..:.. :|..|:.|   ||:..|:::.|...
  Fly   572 WLDVRANRITQLGNYFEIESELSLSTFDASYNLLTEITASSIPNSVEV---LYLNDNQISKIQPY 633

  Fly   410 KLHEEHPDLSELGLHDN 426
            ...:: |:|:.:.|..|
  Fly   634 TFFKK-PNLTRVDLVRN 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 5/22 (23%)
LRR_8 104..163 CDD:290566 18/60 (30%)
leucine-rich repeat 105..128 CDD:275380 6/22 (27%)
LRR_RI 107..438 CDD:238064 97/371 (26%)
leucine-rich repeat 129..152 CDD:275380 8/24 (33%)
leucine-rich repeat 153..176 CDD:275380 7/22 (32%)
LRR_8 176..232 CDD:290566 20/57 (35%)
leucine-rich repeat 177..200 CDD:275380 9/22 (41%)
leucine-rich repeat 201..224 CDD:275380 7/22 (32%)
leucine-rich repeat 225..258 CDD:275380 9/35 (26%)
leucine-rich repeat 259..310 CDD:275380 11/59 (19%)
leucine-rich repeat 311..344 CDD:275380 14/45 (31%)
LRR_8 343..403 CDD:290566 21/83 (25%)
leucine-rich repeat 345..368 CDD:275380 7/27 (26%)
leucine-rich repeat 369..390 CDD:275380 7/21 (33%)
leucine-rich repeat 393..417 CDD:275380 4/23 (17%)
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 22/95 (23%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566 7/20 (35%)
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 118/469 (25%)
leucine-rich repeat 212..235 CDD:275380 7/24 (29%)
leucine-rich repeat 236..259 CDD:275380 7/36 (19%)
leucine-rich repeat 260..283 CDD:275380 4/24 (17%)
LRR_RI 276..558 CDD:238064 77/284 (27%)
leucine-rich repeat 284..307 CDD:275380 6/22 (27%)
leucine-rich repeat 308..333 CDD:275380 8/24 (33%)
leucine-rich repeat 334..357 CDD:275380 7/22 (32%)
leucine-rich repeat 358..381 CDD:275380 9/22 (41%)
leucine-rich repeat 382..405 CDD:275380 7/22 (32%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 4/21 (19%)
leucine-rich repeat 453..500 CDD:275380 11/49 (22%)
leucine-rich repeat 501..521 CDD:275380 6/19 (32%)
leucine-rich repeat 525..547 CDD:275380 6/21 (29%)
leucine-rich repeat 548..573 CDD:275380 6/24 (25%)
leucine-rich repeat 604..640 CDD:275380 8/39 (21%)
leucine-rich repeat 641..688 CDD:275380 3/9 (33%)
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.