DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18249 and kek6

DIOPT Version :9

Sequence 1:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster


Alignment Length:207 Identity:57/207 - (27%)
Similarity:92/207 - (44%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ITWLVLQLTPGLRTLVIRNCATYHISKE-SLRPVENLTSLQMQGTSLGVLRDQIFNAVP-----R 128
            :.|::|.|            ..:.::.: ||....|.|.....|....:........:|     .
  Fly    18 VCWILLCL------------VAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTE 70

  Fly   129 LEILQLSQNFIHTVHVAAFQ--GLSKLRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLP 191
            |::|.|:.|.|..::...|.  ||..|:.:.|:.:.:..|...:...|..||.:|||.|:|..|.
  Fly    71 LQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLD 135

  Fly   192 QNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLD-----LGHAAELEVMTLNL---TNVQN 248
            ::.|..|.:|:.|.||||||:.|.......||:||.||     :.:...:.:..|||   .|::|
  Fly   136 KDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKN 200

  Fly   249 LVLEGSSLSSLV 260
            .:||  |||..|
  Fly   201 NLLE--SLSEYV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 3/9 (33%)
LRR_8 104..163 CDD:290566 14/65 (22%)
leucine-rich repeat 105..128 CDD:275380 3/27 (11%)
LRR_RI 107..438 CDD:238064 50/169 (30%)
leucine-rich repeat 129..152 CDD:275380 8/24 (33%)
leucine-rich repeat 153..176 CDD:275380 4/22 (18%)
LRR_8 176..232 CDD:290566 25/60 (42%)
leucine-rich repeat 177..200 CDD:275380 10/22 (45%)
leucine-rich repeat 201..224 CDD:275380 10/22 (45%)
leucine-rich repeat 225..258 CDD:275380 13/40 (33%)
leucine-rich repeat 259..310 CDD:275380 1/2 (50%)
leucine-rich repeat 311..344 CDD:275380
LRR_8 343..403 CDD:290566
leucine-rich repeat 345..368 CDD:275380
leucine-rich repeat 369..390 CDD:275380
leucine-rich repeat 393..417 CDD:275380
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 8/24 (33%)
LRR_8 96..155 CDD:290566 20/58 (34%)
leucine-rich repeat 97..120 CDD:275380 4/22 (18%)
leucine-rich repeat 121..144 CDD:275380 10/22 (45%)
LRR_4 144..186 CDD:289563 15/41 (37%)
leucine-rich repeat 145..168 CDD:275380 10/22 (45%)
leucine-rich repeat 169..216 CDD:275380 15/44 (34%)
LRRCT 225..274 CDD:214507
Ig 295..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.