DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18249 and Tl

DIOPT Version :10

Sequence 1:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster


Alignment Length:408 Identity:105/408 - (25%)
Similarity:171/408 - (41%) Gaps:77/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLSQNFIHTVHVAAFQGLSKLRLLGLQGNAIAEI 166
            :|||.|::.....|..:...||..:|:|:.|.|..|.:|.:....|:|.:.:..:.:..|.|.::
  Fly   196 LENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQL 260

  Fly   167 LSSTLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQTLLLNGN--PLRILMPDVLGSLPNLRLLD 229
            .......|..:..::||.|...:|||.:|..||.|..:.|..|  ||..|...:..:.|.|::|.
  Fly   261 PHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILR 325

  Fly   230 LGHAAELEVMTLNL----TNVQNLVLEGSSLSSL-------VINGGFIKLQAGNNELNHLQ---V 280
            |  .|||:.:..:|    |.:.|:.|..:.|.:|       .:|  .:.|...||.|.||.   .
  Fly   326 L--RAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVN--LLSLDLSNNRLTHLPDSLF 386

  Fly   281 GNKSSVIEMDLHGNLLNGNDTAALLRGMWNLQRLDLSKNRIEALPQHG----SGL--------DA 333
            .:.:::.::.|..|||.| .:..:...:.||..|.:|:||:..:....    :||        |.
  Fly   387 AHTTNLTDLRLEDNLLTG-ISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDI 450

  Fly   334 SGTQELL-------------ILPSLKFLNLANNQLVRLPPESPILSSRLSYLDLSHNLMLTL--- 382
            ...|.||             .:..|..|||.||.::.:..:......:|..||||:|.:.:|   
  Fly   451 DLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYE 515

  Fly   383 DVAILRSLSVLKGLYVEGNRL------NTINYQKLHEE-------HPDLSELGLHDNPWSSGLYR 434
            |:|.|..           |||      |.|....|.|:       :.:|..:.|:|||.......
  Fly   516 DLAFLSQ-----------NRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTI 569

  Fly   435 KMFLYFTDRGVHLQARPQ 452
            ..|:... ||||   :||
  Fly   570 LWFIQLV-RGVH---KPQ 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380
LRR 105..433 CDD:443914 96/384 (25%)
leucine-rich repeat 105..128 CDD:275380 5/22 (23%)
leucine-rich repeat 129..152 CDD:275380 7/22 (32%)
leucine-rich repeat 153..176 CDD:275380 3/22 (14%)
leucine-rich repeat 177..200 CDD:275380 8/22 (36%)
leucine-rich repeat 201..224 CDD:275380 6/24 (25%)
leucine-rich repeat 225..258 CDD:275380 11/36 (31%)
leucine-rich repeat 259..310 CDD:275380 13/60 (22%)
leucine-rich repeat 311..344 CDD:275380 11/57 (19%)
leucine-rich repeat 345..368 CDD:275380 6/22 (27%)
leucine-rich repeat 369..390 CDD:275380 10/23 (43%)
leucine-rich repeat 393..417 CDD:275380 7/36 (19%)
TlNP_001262995.1 LRR_8 174..233 CDD:404697 12/36 (33%)
leucine-rich repeat 176..198 CDD:275380 0/1 (0%)
leucine-rich repeat 199..222 CDD:275380 5/22 (23%)
LRR 222..576 CDD:443914 91/369 (25%)
leucine-rich repeat 223..270 CDD:275380 10/46 (22%)
leucine-rich repeat 271..294 CDD:275380 8/22 (36%)
leucine-rich repeat 295..320 CDD:275380 6/24 (25%)
leucine-rich repeat 321..343 CDD:275380 7/23 (30%)
leucine-rich repeat 344..367 CDD:275380 4/22 (18%)
leucine-rich repeat 368..391 CDD:275380 6/22 (27%)
leucine-rich repeat 392..415 CDD:275380 5/23 (22%)
leucine-rich repeat 416..439 CDD:275380 5/22 (23%)
leucine-rich repeat 440..474 CDD:275380 5/33 (15%)
leucine-rich repeat 475..498 CDD:275380 6/22 (27%)
leucine-rich repeat 499..520 CDD:275380 9/20 (45%)
leucine-rich repeat 523..552 CDD:275380 7/28 (25%)
LRRCT 561..619 CDD:214507 9/27 (33%)
LRRNT 631..667 CDD:214470
PPP1R42 <660..752 CDD:455733
leucine-rich repeat 664..693 CDD:275380
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.