DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18249 and CG42709

DIOPT Version :9

Sequence 1:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:195 Identity:45/195 - (23%)
Similarity:72/195 - (36%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLSQNFIHTVHVAAFQGLSKL 153
            ||..|::...|...:....:.:....:..||.:.|..:.|...:.|:.|.|.::....|||..:|
  Fly   108 CANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERL 172

  Fly   154 RLLGLQGNAIAEILSSTLDPLMELVHLDLSRNEL------------------------TTLPQNI 194
            :.|.|..|.:.:|...|.....||..||||.|.:                        |.||:..
  Fly   173 KRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWTELPEQT 237

  Fly   195 FAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLDLGHAAELEVMTLNLTNVQNLVLEGSSLSSL 259
            |.....|:.|.||.|       |....:.......|....:|::..|...|::.|.   |.|:|:
  Fly   238 FQNMSGLEVLRLNKN-------DFKQQINTKAFSPLTKIIKLKLPELEQQNIEELC---SLLTSI 292

  Fly   260  259
              Fly   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380
LRR_8 104..163 CDD:290566 14/58 (24%)
leucine-rich repeat 105..128 CDD:275380 3/22 (14%)
LRR_RI 107..438 CDD:238064 41/177 (23%)
leucine-rich repeat 129..152 CDD:275380 6/22 (27%)
leucine-rich repeat 153..176 CDD:275380 6/22 (27%)
LRR_8 176..232 CDD:290566 18/79 (23%)
leucine-rich repeat 177..200 CDD:275380 10/46 (22%)
leucine-rich repeat 201..224 CDD:275380 6/22 (27%)
leucine-rich repeat 225..258 CDD:275380 7/32 (22%)
leucine-rich repeat 259..310 CDD:275380 0/1 (0%)
leucine-rich repeat 311..344 CDD:275380
LRR_8 343..403 CDD:290566
leucine-rich repeat 345..368 CDD:275380
leucine-rich repeat 369..390 CDD:275380
leucine-rich repeat 393..417 CDD:275380
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 14/55 (25%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_RI <150..225 CDD:238064 19/74 (26%)
LRR_8 171..254 CDD:290566 22/89 (25%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 4/22 (18%)
leucine-rich repeat 244..268 CDD:275380 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.