Sequence 1: | NP_001163549.1 | Gene: | CG18249 / 40964 | FlyBaseID: | FBgn0037553 | Length: | 559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 45/195 - (23%) |
---|---|---|---|
Similarity: | 72/195 - (36%) | Gaps: | 34/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 CATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLSQNFIHTVHVAAFQGLSKL 153
Fly 154 RLLGLQGNAIAEILSSTLDPLMELVHLDLSRNEL------------------------TTLPQNI 194
Fly 195 FAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLDLGHAAELEVMTLNLTNVQNLVLEGSSLSSL 259
Fly 260 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18249 | NP_001163549.1 | leucine-rich repeat | 57..80 | CDD:275380 | |
LRR_8 | 104..163 | CDD:290566 | 14/58 (24%) | ||
leucine-rich repeat | 105..128 | CDD:275380 | 3/22 (14%) | ||
LRR_RI | 107..438 | CDD:238064 | 41/177 (23%) | ||
leucine-rich repeat | 129..152 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 153..176 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 176..232 | CDD:290566 | 18/79 (23%) | ||
leucine-rich repeat | 177..200 | CDD:275380 | 10/46 (22%) | ||
leucine-rich repeat | 201..224 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 225..258 | CDD:275380 | 7/32 (22%) | ||
leucine-rich repeat | 259..310 | CDD:275380 | 0/1 (0%) | ||
leucine-rich repeat | 311..344 | CDD:275380 | |||
LRR_8 | 343..403 | CDD:290566 | |||
leucine-rich repeat | 345..368 | CDD:275380 | |||
leucine-rich repeat | 369..390 | CDD:275380 | |||
leucine-rich repeat | 393..417 | CDD:275380 | |||
CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 14/55 (25%) |
leucine-rich repeat | 128..147 | CDD:275380 | 3/18 (17%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | <150..225 | CDD:238064 | 19/74 (26%) | ||
LRR_8 | 171..254 | CDD:290566 | 22/89 (25%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 244..268 | CDD:275380 | 7/30 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453774 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |