DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18249 and 18w

DIOPT Version :9

Sequence 1:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster


Alignment Length:638 Identity:143/638 - (22%)
Similarity:235/638 - (36%) Gaps:211/638 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLTVSDA----------------LAVYDASGRFNLSASCPDSFCSLSDRPVAYSATPAL-----Q 56
            |||..|.                |.|.:|:||.:|  .|.......|:      ..|.|     :
  Fly    35 GLTTMDIRCSVRALESGTGTPLDLQVAEAAGRLDL--QCSQELLHASE------LAPGLFRQLQK 91

  Fly    57 LRELHLRNCSRQSITWLVLQLTPGLRTLVIRN-------CATYHISKESLRPVENLTSLQMQGTS 114
            |.||.:..|..|.:.....:....|:.|.:.:       ..|..:..:|.:.::.|:.|.:...:
  Fly    92 LSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNN 156

  Fly   115 LGVLRDQIFNAVPRLEILQLSQNFIHTVHVAAFQ------------------------------- 148
            :..|.:.::.::|.|::|.|:||.|.:.....|.                               
  Fly   157 IRQLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNE 221

  Fly   149 --------GLSKLR---LLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQ 202
                    |.|:||   .|.||.|.|:.:..:.|..|..|..|::|.|.|.:||...||.||:|:
  Fly   222 LRSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELR 286

  Fly   203 TLLLNGNPLRILMPDVLGSLPNLRLLDLG-------------HAAELEVMTLNLTNVQNLVLEGS 254
            .|.|.||.|..|...:|..|..|.:|||.             .|..:.::.|||:|.....:...
  Fly   287 ELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSK 351

  Fly   255 SLSSLVINGGFIK-LQAGNNELNHLQVG--------NKSSVIEMDLH---GNLLNG--------- 298
            :...|.    |:: |...||.:.|::.|        :..::.|..||   ..:.||         
  Fly   352 TFKELY----FLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTL 412

  Fly   299 -NDTAALL-----RGMWNLQRLDLSKNRIEALPQHGSGLDASGTQEL------------------ 339
             |:..:::     |...:|:.||||.|::..:|:....|....|.:|                  
  Fly   413 NNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQ 477

  Fly   340 -----LI--------------LPSLKFLNLANNQL----------------VRLPPESPILS--- 366
                 ||              ||.|..||||.|::                :||  :...|:   
  Fly   478 LTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRL--DKNFLTDIN 540

  Fly   367 ------SRLSYLDLSHNLMLTLDVAILRSLSVLKGLYVEGNRLNTI-NYQKLHEE---------H 415
                  :.|.:|:||.|.::..|.|.:.  |.||.|.:.||.:..: ||.||.||         |
  Fly   541 GIFATLASLLWLNLSENHLVWFDYAFIP--SNLKWLDIHGNYIEALGNYYKLQEEIRVTTLDASH 603

  Fly   416 PDLSELGLHDNPWSSGLYRKMFLYFTDRGV--HLQARPQNRVLNKS--SRVDI 464
            ..::|:|....|      ..:.|.|.:..:  .:||   |..::|:  :|||:
  Fly   604 NRITEIGAMSVP------NSIELLFINNNIIGQIQA---NTFVDKTRLARVDL 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 5/22 (23%)
LRR_8 104..163 CDD:290566 19/100 (19%)
leucine-rich repeat 105..128 CDD:275380 3/22 (14%)
LRR_RI 107..438 CDD:238064 110/484 (23%)
leucine-rich repeat 129..152 CDD:275380 8/61 (13%)
leucine-rich repeat 153..176 CDD:275380 9/25 (36%)
LRR_8 176..232 CDD:290566 24/68 (35%)
leucine-rich repeat 177..200 CDD:275380 10/22 (45%)
leucine-rich repeat 201..224 CDD:275380 9/22 (41%)
leucine-rich repeat 225..258 CDD:275380 9/45 (20%)
leucine-rich repeat 259..310 CDD:275380 14/77 (18%)
leucine-rich repeat 311..344 CDD:275380 13/69 (19%)
LRR_8 343..403 CDD:290566 23/84 (27%)
leucine-rich repeat 345..368 CDD:275380 9/47 (19%)
leucine-rich repeat 369..390 CDD:275380 7/20 (35%)
leucine-rich repeat 393..417 CDD:275380 12/33 (36%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 6/32 (19%)
leucine-rich repeat 92..115 CDD:275380 5/22 (23%)
LRR_8 115..181 CDD:290566 13/65 (20%)
leucine-rich repeat 116..146 CDD:275380 4/29 (14%)
leucine-rich repeat 147..170 CDD:275380 3/22 (14%)
leucine-rich repeat 171..201 CDD:275380 7/29 (24%)
LRR_RI 210..464 CDD:238064 64/257 (25%)
leucine-rich repeat 212..236 CDD:275380 3/23 (13%)
LRR_8 235..295 CDD:290566 24/59 (41%)
leucine-rich repeat 237..260 CDD:275380 7/22 (32%)
leucine-rich repeat 261..284 CDD:275380 10/22 (45%)
LRR_8 283..345 CDD:290566 19/61 (31%)
leucine-rich repeat 285..308 CDD:275380 9/22 (41%)
leucine-rich repeat 309..334 CDD:275380 5/24 (21%)
LRR_8 334..393 CDD:290566 12/62 (19%)
leucine-rich repeat 335..358 CDD:275380 5/26 (19%)
leucine-rich repeat 359..382 CDD:275380 5/22 (23%)
LRR_8 382..441 CDD:290566 13/58 (22%)
leucine-rich repeat 383..406 CDD:275380 5/22 (23%)
leucine-rich repeat 407..430 CDD:275380 2/22 (9%)
LRR_8 431..488 CDD:290566 12/56 (21%)
leucine-rich repeat 431..451 CDD:275380 7/19 (37%)
leucine-rich repeat 454..477 CDD:275380 2/22 (9%)
LRR_8 477..559 CDD:290566 18/83 (22%)
leucine-rich repeat 478..499 CDD:275380 2/20 (10%)
leucine-rich repeat 502..525 CDD:275380 6/22 (27%)
leucine-rich repeat 526..548 CDD:275380 3/23 (13%)
leucine-rich repeat 590..617 CDD:275380 7/32 (22%)
leucine-rich repeat 618..641 CDD:275380 6/25 (24%)
leucine-rich repeat 642..689 CDD:275380 3/6 (50%)
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.