DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18249 and CG16974

DIOPT Version :9

Sequence 1:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:402 Identity:102/402 - (25%)
Similarity:162/402 - (40%) Gaps:80/402 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RPVAYSATPALQLRELHLRNCSRQSITWLVLQLTPGLRTLVIRNCATYHISKESLRPVENLTSLQ 109
            :|.::.....|.|.|..|     :.:.|.:......::.|.:......:.|..:|:.::.|..|.
  Fly   198 QPRSFEYMERLNLAENRL-----ECLHWAIPLAVRRVKVLEMSGNRLSNCSLLNLQYMKQLQELH 257

  Fly   110 MQGTSLGVLRDQIFNAVPRLEILQLSQNFIHTVHVAAFQGLSKLRLLGLQGNAIAEILSSTLDPL 174
            :..:.|..|..:....:..|.:|.||||.:..:....|.|..||..|.|.||.::.:........
  Fly   258 LDRSELTYLPQRFLGELSELRMLNLSQNLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTA 322

  Fly   175 MELVHLDLSRNELTTLPQNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLDLGHAAELEVM 239
            .:|..||||.|.|.:.|.|.||:|.:|:.|.|..|.|:.:....|.||..||.|||.        
  Fly   323 ADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQLDLS-------- 379

  Fly   240 TLNLTNVQN--LVLEGSSLSSLVINGGFIKLQAGNNELNHLQVGNKSSVIEMDLHGNLLNGNDTA 302
                   ||  .|::..:..||   ...:.|....|.|..|     ||:|...||.         
  Fly   380 -------QNSLSVIDRKAFESL---DHLLALNVSGNNLTLL-----SSIIFQSLHA--------- 420

  Fly   303 ALLRGMWNLQRLDLSKNRIEALPQHGSGL------------DASGTQEL--------------LI 341
                    |::||||:|:.:.||   |||            |.:..::.              .:
  Fly   421 --------LRQLDLSRNQFKQLP---SGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDPQV 474

  Fly   342 LPSLKFLNL-ANNQLVRLPPESPILSSRLSYLDLSHNLMLTLDVAILRSLSVLKGLYVEGNRLNT 405
            |..|::|:: .|.:|..||......:..:..|.|:.|.:|.|...| ..||.|:.|.|.||.|.:
  Fly   475 LHRLRYLSVQQNRKLTYLPATLFANTPNIRELLLAENGLLQLPTQI-SGLSRLQRLSVRGNSLGS 538

  Fly   406 I--NYQKLHEEH 415
            :  |.::|.:.|
  Fly   539 LPENIKELRQLH 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 4/22 (18%)
LRR_8 104..163 CDD:290566 18/58 (31%)
leucine-rich repeat 105..128 CDD:275380 4/22 (18%)
LRR_RI 107..438 CDD:238064 92/340 (27%)
leucine-rich repeat 129..152 CDD:275380 8/22 (36%)
leucine-rich repeat 153..176 CDD:275380 5/22 (23%)
LRR_8 176..232 CDD:290566 25/55 (45%)
leucine-rich repeat 177..200 CDD:275380 12/22 (55%)
leucine-rich repeat 201..224 CDD:275380 8/22 (36%)
leucine-rich repeat 225..258 CDD:275380 8/34 (24%)
leucine-rich repeat 259..310 CDD:275380 10/50 (20%)
leucine-rich repeat 311..344 CDD:275380 13/58 (22%)
LRR_8 343..403 CDD:290566 19/60 (32%)
leucine-rich repeat 345..368 CDD:275380 6/23 (26%)
leucine-rich repeat 369..390 CDD:275380 6/20 (30%)
leucine-rich repeat 393..417 CDD:275380 9/25 (36%)
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 5/26 (19%)
leucine-rich repeat 229..252 CDD:275380 3/22 (14%)
LRR_RI <246..433 CDD:238064 64/226 (28%)
LRR_8 251..311 CDD:290566 18/59 (31%)
leucine-rich repeat 253..276 CDD:275380 4/22 (18%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
LRR_8 325..383 CDD:290566 27/72 (38%)
leucine-rich repeat 325..348 CDD:275380 12/22 (55%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
LRR_RI 351..>557 CDD:238064 62/244 (25%)
LRR_8 371..431 CDD:290566 25/99 (25%)
leucine-rich repeat 373..396 CDD:275380 10/40 (25%)
leucine-rich repeat 397..420 CDD:275380 8/27 (30%)
leucine-rich repeat 421..444 CDD:275380 11/25 (44%)
LRR_8 477..536 CDD:290566 19/59 (32%)
leucine-rich repeat 478..502 CDD:275380 6/23 (26%)
leucine-rich repeat 503..526 CDD:275380 8/23 (35%)
Ig <714..761 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.