DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18249 and Toll-4

DIOPT Version :9

Sequence 1:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster


Alignment Length:487 Identity:102/487 - (20%)
Similarity:168/487 - (34%) Gaps:182/487 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LRTLVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLSQ-----NFI- 139
            ||:..:::..||.|.|     |:|:..|:.            |.....|||:::||     ||. 
  Fly   304 LRSSTLQSSLTYCIMK-----VDNMVDLKS------------FEKFTNLEIIEVSQYKGFKNFTA 351

  Fly   140 -----HTVHVAAFQGL-----------------SKLRL----------------------LGLQG 160
                 :..|.....|:                 |:|.:                      |..|.
  Fly   352 FICEPYKSHCKFTLGINEVACPLKCNCSYNRDKSQLEIDCWQKNLTTIPSLPVPKKGSSALVFQS 416

  Fly   161 NAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNL 225
            |.:||:..::|:....|..||:|.|:||:|  ::....:.|..|.:..|.:..|.|.|:..|.::
  Fly   417 NLLAELPDNSLEGYHNLKSLDVSYNQLTSL--SVSQLPESLHYLDIRHNKITTLSPQVVEYLYSV 479

  Fly   226 RLL-----------DLGHAAEL-----EVMTLNLTNVQNLV--LEGSSLSSLVINGGFIK----- 267
            .:.           |..|..|.     :::.:..:..|.::  :|.||..|.|.| .|::     
  Fly   480 NVFNQYGNKWSIYCDEYHLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVEN-FFVQNIDQL 543

  Fly   268 -LQAGNNE-------------------LNH---LQVGNKSSVIEMDLHGNLLNGN---------- 299
             |:|..:|                   |||   |..|....:|   ||.  ||..          
  Fly   544 YLEANEDEIIDAFGPSDKYFNLKLMEALNHAIWLFSGEFDEII---LHH--LNSPCPYRCSCCFE 603

  Fly   300 -DTAALLRGMWNLQ---------------RLDLSKNRIEALPQHGSGLDASGTQELLIL--PSLK 346
             .|...|....||.               .|.|.:|.|..|         :.|:.|::.  .|:.
  Fly   604 WHTGEFLINCRNLSLDIYPRLPNSIPYKTTLYLDRNEIRKL---------TNTESLVVAGHASIH 659

  Fly   347 FLNLANNQLVRLPPESPILSSRLSYLDLSHNLMLTLDVAILRSLSVLKGLYVEGNRLNTINYQKL 411
            .|:::.|.|..||..  :|...::|||:.:||:..||..::..|                     
  Fly   660 KLHMSQNLLRELPLH--LLPENITYLDVRNNLLKYLDDGVIAFL--------------------- 701

  Fly   412 HEEHPDLSELGLHDNPWSSGLYRKMFLYFTDR 443
             |...:::::.|..|||......|.||.|..|
  Fly   702 -EYRENITKIELSGNPWECNCKAKAFLSFLRR 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380
LRR_8 104..163 CDD:290566 17/108 (16%)
leucine-rich repeat 105..128 CDD:275380 2/22 (9%)
LRR_RI 107..438 CDD:238064 90/454 (20%)
leucine-rich repeat 129..152 CDD:275380 9/50 (18%)
leucine-rich repeat 153..176 CDD:275380 7/44 (16%)
LRR_8 176..232 CDD:290566 16/66 (24%)
leucine-rich repeat 177..200 CDD:275380 8/22 (36%)
leucine-rich repeat 201..224 CDD:275380 7/22 (32%)
leucine-rich repeat 225..258 CDD:275380 7/50 (14%)
leucine-rich repeat 259..310 CDD:275380 18/89 (20%)
leucine-rich repeat 311..344 CDD:275380 8/49 (16%)
LRR_8 343..403 CDD:290566 15/59 (25%)
leucine-rich repeat 345..368 CDD:275380 6/22 (27%)
leucine-rich repeat 369..390 CDD:275380 7/20 (35%)
leucine-rich repeat 393..417 CDD:275380 1/23 (4%)
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380 2/3 (67%)
leucine-rich repeat 309..334 CDD:275380 8/41 (20%)
leucine-rich repeat 335..386 CDD:275380 9/50 (18%)
leucine-rich repeat 388..408 CDD:275380 0/19 (0%)
LRR_8 412..465 CDD:290566 17/54 (31%)
leucine-rich repeat 412..432 CDD:275378 6/19 (32%)
LRR_4 432..470 CDD:289563 12/39 (31%)
leucine-rich repeat 433..454 CDD:275378 8/22 (36%)
leucine-rich repeat 455..478 CDD:275378 7/22 (32%)
leucine-rich repeat 479..490 CDD:275378 0/10 (0%)
leucine-rich repeat 632..657 CDD:275378 7/33 (21%)
leucine-rich repeat 658..679 CDD:275378 6/22 (27%)
leucine-rich repeat 680..706 CDD:275378 9/47 (19%)
leucine-rich repeat 707..719 CDD:275378 4/11 (36%)
leucine-rich repeat 771..791 CDD:275380
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.