DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and AT5G48940

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_199705.2 Gene:AT5G48940 / 834952 AraportID:AT5G48940 Length:1135 Species:Arabidopsis thaliana


Alignment Length:347 Identity:95/347 - (27%)
Similarity:154/347 - (44%) Gaps:85/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TKLTEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLR-RGNLLGLHDEHF 107
            |||.:|.:|:  .::..|:|            |:..:  |.:|......|.: .||:    .:..
plant   371 TKLVQFQIDA--NQISGLIP------------PEIGL--LKELNIFLGWQNKLEGNI----PDEL 415

  Fly   108 SKWPNMKILMLGGNNIT-RLSNECF--KGLAQLWLLSLPGNGIQG-LPWDVFQNLPELLHLDLSG 168
            :...|::.|.|..|.:| .|....|  :.|.:|.|:|   |.|.| :|.:: .|...|:.|.|..
plant   416 AGCQNLQALDLSQNYLTGSLPAGLFQLRNLTKLLLIS---NAISGVIPLEI-GNCTSLVRLRLVN 476

  Fly   169 NRIE----------------TLHENIFTG-VP-------KLEMLLLNGNPLTWIAPTSLKSLSNL 209
            |||.                .|.||..:| ||       :|:||.|:.|.|....|.||.||:.|
plant   477 NRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKL 541

  Fly   210 RLLDMSN---CGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSS---- 267
            ::||:|:   .|.:|| ||  .|.:.|:...:.:....|   ::.:...|.|.::|.|.||    
plant   542 QVLDVSSNDLTGKIPD-SL--GHLISLNRLILSKNSFNG---EIPSSLGHCTNLQLLDLSSNNIS 600

  Fly   268 ---------VIELDLHSNL-LTATD--IPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELFIL 320
                     :.:||:..|| ..:.|  ||:.::.:.||..||:|.|::       |.:.|.|..|
plant   601 GTIPEELFDIQDLDIALNLSWNSLDGFIPERISALNRLSVLDISHNML-------SGDLSALSGL 658

  Fly   321 PNLMYMNLSANRLTRLHFDSPI 342
            .||:.:|:|.||.:....||.:
plant   659 ENLVSLNISHNRFSGYLPDSKV 680

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 4/17 (24%)
leucine-rich repeat 65..85 CDD:275380 2/19 (11%)
LRR_8 87..147 CDD:290566 15/63 (24%)
leucine-rich repeat 89..112 CDD:275380 3/23 (13%)
leucine-rich repeat 113..136 CDD:275380 7/25 (28%)
LRR_RI <131..334 CDD:238064 74/248 (30%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 23/79 (29%)
leucine-rich repeat 161..184 CDD:275380 12/46 (26%)
leucine-rich repeat 185..208 CDD:275380 11/22 (50%)
leucine-rich repeat 209..246 CDD:275380 11/39 (28%)
leucine-rich repeat 247..267 CDD:275380 4/19 (21%)
leucine-rich repeat 268..292 CDD:275380 7/26 (27%)
leucine-rich repeat 293..322 CDD:275380 9/28 (32%)
leucine-rich repeat 395..406 CDD:275378
AT5G48940NP_199705.2 PLN00113 16..1063 CDD:215061 95/347 (27%)
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..182 CDD:275380
leucine-rich repeat 229..252 CDD:275380
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 329..348 CDD:275380