| Sequence 1: | NP_649770.1 | Gene: | CG7800 / 40963 | FlyBaseID: | FBgn0037552 | Length: | 533 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001038237.1 | Gene: | si:dkey-90m5.4 / 553466 | ZFINID: | ZDB-GENE-041014-250 | Length: | 327 | Species: | Danio rerio |
| Alignment Length: | 272 | Identity: | 80/272 - (29%) |
|---|---|---|---|
| Similarity: | 124/272 - (45%) | Gaps: | 42/272 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 PYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLP 151
Fly 152 WDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMS- 215
Fly 216 -NCGPLPDLSLPGAHT----LILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELDLHS 275
Fly 276 NLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSANRLT--RLHF 338
Fly 339 DSPIP--WERLT 348 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7800 | NP_649770.1 | leucine-rich repeat | 46..64 | CDD:275380 | |
| leucine-rich repeat | 65..85 | CDD:275380 | |||
| LRR_8 | 87..147 | CDD:290566 | 20/59 (34%) | ||
| leucine-rich repeat | 89..112 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 113..136 | CDD:275380 | 7/22 (32%) | ||
| LRR_RI | <131..334 | CDD:238064 | 58/208 (28%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 140..195 | CDD:290566 | 21/54 (39%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 209..246 | CDD:275380 | 14/42 (33%) | ||
| leucine-rich repeat | 247..267 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 268..292 | CDD:275380 | 2/23 (9%) | ||
| leucine-rich repeat | 293..322 | CDD:275380 | 6/28 (21%) | ||
| leucine-rich repeat | 395..406 | CDD:275378 | |||
| si:dkey-90m5.4 | NP_001038237.1 | LRR_8 | 55..115 | CDD:404697 | 20/59 (34%) |
| leucine-rich repeat | 57..80 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 81..104 | CDD:275380 | 7/22 (32%) | ||
| PPP1R42 | 102..279 | CDD:411060 | 59/208 (28%) | ||
| leucine-rich repeat | 105..126 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 128..151 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 152..175 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 176..199 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 200..223 | CDD:275380 | 7/27 (26%) | ||
| leucine-rich repeat | 224..247 | CDD:275380 | 6/34 (18%) | ||
| leucine-rich repeat | 248..271 | CDD:275380 | 8/35 (23%) | ||
| TPKR_C2 | 278..319 | CDD:417692 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45617 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||