DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and chp

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster


Alignment Length:499 Identity:118/499 - (23%)
Similarity:195/499 - (39%) Gaps:134/499 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HLLGRSR-TFSDKKATKLTEFHMDSCEKKVLKL-------------------------------M 62
            ||...|: ||.|.:|  |.:.|:|  :.|:.|:                               :
  Fly   584 HLTSISQHTFFDLEA--LRKLHLD--DNKIDKIERRAFMNLDELEYLSLRGNKINNLADESFQNL 644

  Fly    63 PNLRTLELENCDSPDFTMNDLNQLPYLTSL----------QLRRGNLLGLHDEHFSKW-PNMKIL 116
            |.|..|::.....|:|..:..:|:..|::|          ||...:.....:||...: .|:|||
  Fly   645 PKLEILDMAFNQLPNFNFDYFDQVGTLSNLNVNVSHNQIRQLMYNSSWSGRNEHGGMYHSNIKIL 709

  Fly   117 MLGGNNITRLSNECFKGLAQLWL--LSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIF 179
            .|..|||:.:....|:. |::.|  |.|..|.:.....|||.|:|.|..||||.|.|..|..:.|
  Fly   710 DLSHNNISIIHPGYFRP-AEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIHELDFDAF 773

  Fly   180 TGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMS--NCGPLPDLSLPGAHTLILDNSGVQRLD 242
            ....:|:::....|.|:.|.....|.:..||::|.|  :...|||        .:..|.|:::||
  Fly   774 KNTKQLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPD--------NLFYNGGMEKLD 830

  Fly   243 ILGSVHKLQARKNHITEIKLPDKS-------SVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSE 300
            :           :|...:|:|..|       ::.||.|.:|.::.            :..:|||.
  Fly   831 V-----------SHNMMLKIPSSSLSSLAALTLCELHLSNNFIST------------IHSMDLSN 872

  Fly   301 NIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYAPAKVGI 365
            .                  ..:|.|:::|.|.|.|:.........:|..||.|:||   ..|| :
  Fly   873 K------------------FRSLRYLDISYNYLLRIDDAVFATMPKLAVLDLSHNR---DLKV-M 915

  Fly   366 DEAFNLQSLHLEGNYI----NNFELTPWKPHPSLKEVAL-YDNKFQPKGYKNITKFFNEIGVNVL 425
            |::|    :.||.:.|    .|..|:      ::.|:.| |..:|: .||..:.....|:..|:.
  Fly   916 DKSF----MGLENSLIKLGLENISLS------TVPEIRLKYLREFR-LGYNELPSIPQELAHNMS 969

  Fly   426 EKTQYSQSNN---TTPTCKPCIPDARDFPTS---ISADTNQTID 463
            .......|||   ..|.....:|..|....|   |::..|.:.|
  Fly   970 NLRMLDLSNNDLTNVPLMTQALPHLRRLMLSGNPITSLNNNSFD 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 5/48 (10%)
leucine-rich repeat 65..85 CDD:275380 4/19 (21%)
LRR_8 87..147 CDD:290566 20/72 (28%)
leucine-rich repeat 89..112 CDD:275380 6/33 (18%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
LRR_RI <131..334 CDD:238064 51/213 (24%)
leucine-rich repeat 137..160 CDD:275380 8/24 (33%)
LRR_8 140..195 CDD:290566 19/54 (35%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..246 CDD:275380 11/38 (29%)
leucine-rich repeat 247..267 CDD:275380 4/26 (15%)
leucine-rich repeat 268..292 CDD:275380 4/23 (17%)
leucine-rich repeat 293..322 CDD:275380 3/28 (11%)
leucine-rich repeat 395..406 CDD:275378 3/11 (27%)
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
LRR_RI <448..651 CDD:238064 14/70 (20%)
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:290566
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
leucine-rich repeat 549..574 CDD:275380
LRR_8 573..633 CDD:290566 12/52 (23%)
leucine-rich repeat 575..598 CDD:275380 6/13 (46%)
leucine-rich repeat 599..622 CDD:275380 5/24 (21%)
LRR_8 622..683 CDD:290566 8/60 (13%)
leucine-rich repeat 623..646 CDD:275380 0/22 (0%)
leucine-rich repeat 647..730 CDD:275380 21/83 (25%)
leucine-rich repeat 648..673 CDD:275380 5/24 (21%)
leucine-rich repeat 674..705 CDD:275380 5/30 (17%)
LRR_8 704..763 CDD:290566 24/59 (41%)
leucine-rich repeat 731..754 CDD:275380 8/22 (36%)
LRR_8 753..813 CDD:290566 19/59 (32%)
leucine-rich repeat 755..778 CDD:275380 9/22 (41%)
leucine-rich repeat 779..802 CDD:275380 5/22 (23%)
leucine-rich repeat 803..823 CDD:275380 7/27 (26%)
leucine-rich repeat 852..876 CDD:275380 7/53 (13%)
LRR_8 854..910 CDD:290566 17/85 (20%)
LRR_RI <877..>1006 CDD:238064 37/143 (26%)
leucine-rich repeat 877..900 CDD:275380 6/22 (27%)
leucine-rich repeat 901..925 CDD:275380 12/31 (39%)
leucine-rich repeat 926..946 CDD:275380 5/25 (20%)
LRR_8 947..1004 CDD:290566 12/57 (21%)
leucine-rich repeat 947..970 CDD:275380 5/23 (22%)
leucine-rich repeat 971..993 CDD:275380 4/21 (19%)
LRR_8 992..1049 CDD:290566 6/22 (27%)
leucine-rich repeat 994..1014 CDD:275380 5/20 (25%)
leucine-rich repeat 1019..1042 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.