DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and CG7896

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster


Alignment Length:673 Identity:157/673 - (23%)
Similarity:238/673 - (35%) Gaps:220/673 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TFSDKKATKLTEFHMDSCEKKVLKLMPNLRTLE---LENCDS-PDFTMND----------LNQLP 87
            ||.:..|.|..:..::|           |||:|   ||..|| ....:.|          |.:||
  Fly   347 TFREMGALKYLDLSLNS-----------LRTIEDDALEGLDSLQTLIIKDNNILLVPGSALGRLP 400

  Fly    88 YLTSLQLRRGNLLGLHDE--------------------------HFSKWPNMKILMLGGNNITRL 126
            .||||||....:..|..|                          .|..:.::..|.|.||::..:
  Fly   401 QLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSLAVI 465

  Fly   127 SNECFKGL-AQLWLLSLPGN---GIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEM 187
            :.:.|.|| :.|..|.|..|   |:.|.||    .||||..||||||.:..|...||..:..::.
  Fly   466 NADTFAGLESTLMALKLSQNRLTGLGGAPW----VLPELRSLDLSGNTLTELPSTIFEELENVQS 526

  Fly   188 LLLNGNPLTWIAPTSLKSLSNLRLLDMSNC----------GPLPDLSLPGAHTLILDNSGVQRLD 242
            |.|:||.||.:.....|.|..|:::|:|.|          ..|.||.    |..:.||. :|.|.
  Fly   527 LNLSGNHLTPLTGALFKPLDRLQVIDLSGCNIRQISGDLLAGLQDLK----HIYLNDNQ-LQELQ 586

  Fly   243 -----ILGSVHKLQARKNHITEIKLPDKSSVI---ELDLHSNLLTATDIPKLLTGMWRLQRLDLS 299
                 .|.::..:....|.|..|:.....:|:   :||||.|.|:|.......||. .::.||:|
  Fly   587 DGSFVNLWNISSIDLSNNRIGSIRSGAFVNVMKLQKLDLHGNQLSAFKGEYFNTGT-GIEELDIS 650

  Fly   300 ENIIG------------IYAAAGSDNTSELF---ILPNLMYM---NLSANRL------------- 333
            :|.:.            :.....::|....|   ::..|.|:   :||.|:|             
  Fly   651 DNQLSYLFPSSFRIHPRLREIRAANNKFSFFPAELISTLQYLEHIDLSHNQLKTIEELDFARLPR 715

  Fly   334 --------TRLHFDSPIPWERLTH---LDASYNRIYAPAKVGIDEAFNLQSLHLEGNYI------ 381
                    .:|...|.:.:...|.   ||.::|.:....:...:....|:.|:||||.:      
  Fly   716 LRVLLVANNQLDMVSEMAFHNSTQLQILDLAHNNLDRIGERTFEGLVRLEQLNLEGNRLSELSDG 780

  Fly   382 -----------------NNFELTPWK--------------PHPSLKE----------VALYDNKF 405
                             |.||..|..              .|..:||          :...|..|
  Fly   781 VFERTKLQMLENINLAHNRFEYAPLNALQRQFFFVSSVDLSHNKIKELPGDDSIMVNIKRIDLSF 845

  Fly   406 QPKGYKNITKFFNE-----------IGVNVLE--KTQYSQ----SNNTTPTCKPCIPDARDFPTS 453
            .|...|.:....||           .|:..||  :|.:.|    |:|.....||.:........:
  Fly   846 NPLSSKAVHNVLNEPKTVRELSLAGTGIENLELLETPFLQFLNLSHNKLKNVKPEVFQRVTLLET 910

  Fly   454 ISADTNQTIDTKVNPLSNDTYQWNVWNVLMLVSLIVSLFVNSFLIV------KLIRLRG------ 506
            :...:||     :..|.:.:..|....||.  ||.||  .|||.||      ||..||.      
  Fly   911 LDLSSNQ-----LESLEDLSMAWPQLQVLQ--SLDVS--NNSFEIVSQSNFGKLEMLRSLRLSHL 966

  Fly   507 -------RNQFTQSSSVPAIIEM 522
                   :|.|.|   :|.::.:
  Fly   967 PQCTRIEKNAFKQ---LPNLVSL 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 1/17 (6%)
leucine-rich repeat 65..85 CDD:275380 10/33 (30%)
LRR_8 87..147 CDD:290566 21/89 (24%)
leucine-rich repeat 89..112 CDD:275380 9/48 (19%)
leucine-rich repeat 113..136 CDD:275380 7/23 (30%)
LRR_RI <131..334 CDD:238064 70/263 (27%)
leucine-rich repeat 137..160 CDD:275380 9/25 (36%)
LRR_8 140..195 CDD:290566 24/57 (42%)
leucine-rich repeat 161..184 CDD:275380 10/22 (45%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..246 CDD:275380 13/51 (25%)
leucine-rich repeat 247..267 CDD:275380 3/19 (16%)
leucine-rich repeat 268..292 CDD:275380 10/26 (38%)
leucine-rich repeat 293..322 CDD:275380 6/43 (14%)
leucine-rich repeat 395..406 CDD:275378 3/20 (15%)
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
LRR_8 232..290 CDD:290566
leucine-rich repeat 234..257 CDD:275380
leucine-rich repeat 258..281 CDD:275380
LRR_RI 273..535 CDD:238064 58/202 (29%)
LRR_8 281..338 CDD:290566
leucine-rich repeat 282..329 CDD:275380
LRR_8 328..388 CDD:290566 14/51 (27%)
leucine-rich repeat 330..353 CDD:275380 2/5 (40%)
leucine-rich repeat 354..377 CDD:275380 8/33 (24%)
leucine-rich repeat 378..401 CDD:275380 3/22 (14%)
leucine-rich repeat 402..425 CDD:275380 8/22 (36%)
leucine-rich repeat 428..451 CDD:275380 1/22 (5%)
LRR_8 429..487 CDD:290566 12/57 (21%)
leucine-rich repeat 452..473 CDD:275380 5/20 (25%)
leucine-rich repeat 477..497 CDD:275378 8/23 (35%)
LRR_8 498..558 CDD:290566 24/59 (41%)
leucine-rich repeat 500..523 CDD:275380 10/22 (45%)
LRR_RI 502..769 CDD:238064 63/272 (23%)
leucine-rich repeat 524..547 CDD:275380 8/22 (36%)
leucine-rich repeat 548..571 CDD:275380 5/22 (23%)
LRR_8 572..630 CDD:290566 16/62 (26%)
leucine-rich repeat 572..595 CDD:275380 7/27 (26%)
leucine-rich repeat 596..619 CDD:275380 4/22 (18%)
LRR_8 619..678 CDD:290566 14/59 (24%)
leucine-rich repeat 620..643 CDD:275380 9/23 (39%)
leucine-rich repeat 644..667 CDD:275380 4/22 (18%)
LRR_8 666..726 CDD:290566 8/59 (14%)
leucine-rich repeat 668..691 CDD:275380 3/22 (14%)
leucine-rich repeat 692..715 CDD:275380 4/22 (18%)
LRR_8 714..774 CDD:290566 12/59 (20%)
leucine-rich repeat 716..739 CDD:275380 2/22 (9%)
leucine-rich repeat 740..761 CDD:275380 3/20 (15%)
leucine-rich repeat 764..789 CDD:275380 6/24 (25%)
leucine-rich repeat 790..810 CDD:275380 4/19 (21%)
leucine-rich repeat 818..850 CDD:275380 6/31 (19%)
leucine-rich repeat 863..883 CDD:275378 4/19 (21%)
LRR_RI <878..1070 CDD:238064 29/121 (24%)
LRR_8 884..944 CDD:290566 16/68 (24%)
LRR_4 884..925 CDD:289563 8/45 (18%)
leucine-rich repeat 884..907 CDD:275380 5/22 (23%)
leucine-rich repeat 908..933 CDD:275380 4/29 (14%)
leucine-rich repeat 934..955 CDD:275380 10/24 (42%)
leucine-rich repeat 958..982 CDD:275380 5/26 (19%)
leucine-rich repeat 983..1055 CDD:275380 0/4 (0%)
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.