DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and CG5810

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:447 Identity:101/447 - (22%)
Similarity:163/447 - (36%) Gaps:134/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YL--IIIALLASVSALGRPDLEDYCNDSY-CHLLGRSRTFSDKK---ATKLTEFHMDSCEKKVLK 60
            ||  |:||::|..:...: .||:...||. |    |..|.::.|   |:.:..|     .:.|.|
  Fly     6 YLNYILIAVIAFATCESQ-KLEEIAIDSLDC----RENTCTNLKYPSASAVAYF-----SENVTK 60

  Fly    61 LMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITR 125
            .:....||.|.:.|..:........||.|....:....|..:....|....|:|.|..|||.:..
  Fly    61 HLRKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFGGNALRV 125

  Fly   126 LSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLL 190
            |.:..|:...||..|:|..|.::.||..:|:.|..|..::||.||:.||.::||:.:..|:.:.:
  Fly   126 LDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINV 190

  Fly   191 NGNPLTWIAPTSL-----KSLS-----------------------------NLRLLDMS------ 215
            :.|.|..: |..|     |.||                             .||.|.:|      
  Fly   191 DSNQLVEL-PGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNPQLRRLHLSAKINEL 254

  Fly   216 ---NCGPLPDLSLPG-----------------------AHTLILDNSGVQRLDILGSVHKLQARK 254
               || .|..:.|.|                       ...|.|.|:.:.|||.|....||    
  Fly   255 EATNC-DLESVELDGRVIGVQLEANPKLHELKISQPQDLEHLYLANTNLYRLDFLSKASKL---- 314

  Fly   255 NHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELFI 319
                          ::||: ::::...|:|| :|....|:||..:                    
  Fly   315 --------------VDLDV-TDIVNLADLPK-ITSAKGLERLSFT-------------------- 343

  Fly   320 LPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYAPAKVGIDEAFNLQSLHL 376
                 |.||::|     |.|.....:.|.:|:.|:.:........:||.|.::...|
  Fly   344 -----YDNLTSN-----HMDMLPHLKDLNYLEISHEKGKEIFIKDLDEDFFVEEAEL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/17 (18%)
leucine-rich repeat 65..85 CDD:275380 4/19 (21%)
LRR_8 87..147 CDD:290566 17/59 (29%)
leucine-rich repeat 89..112 CDD:275380 3/22 (14%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI <131..334 CDD:238064 58/268 (22%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
LRR_8 140..195 CDD:290566 18/54 (33%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..208 CDD:275380 8/56 (14%)
leucine-rich repeat 209..246 CDD:275380 16/68 (24%)
leucine-rich repeat 247..267 CDD:275380 2/19 (11%)
leucine-rich repeat 268..292 CDD:275380 6/23 (26%)
leucine-rich repeat 293..322 CDD:275380 3/28 (11%)
leucine-rich repeat 395..406 CDD:275378
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 5/22 (23%)
LRR_8 87..147 CDD:290566 17/59 (29%)
leucine-rich repeat 89..112 CDD:275380 3/22 (14%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 20/59 (34%)
LRR_4 135..175 CDD:289563 15/39 (38%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..209 CDD:275380 5/24 (21%)
leucine-rich repeat 210..231 CDD:275380 2/20 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.