DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and atk

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001262113.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster


Alignment Length:491 Identity:128/491 - (26%)
Similarity:191/491 - (38%) Gaps:93/491 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALLASVSALGRPDLEDYCNDSYCHL-LGRSRTFSDKKATKLTEFHMDSCEKKVLKLMPNLRTLEL 70
            ||.|.:.||.|....|...:....| .|..|.....:...|...|:...|:..|..||.||.|.:
  Fly   349 ALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRM 413

  Fly    71 ENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLA 135
            .|        |.|:     :.|.|...||           |.:|.|.|..|...|:.::...||.
  Fly   414 RN--------NSLS-----SDLPLPFWNL-----------PGLKGLDLAQNQFARVDSQLLAGLP 454

  Fly   136 QLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLH--------------------ENIFT 180
            .|..|.|..||:..|..:.|::.|.|..|::|.|.:..:|                    :::..
  Fly   455 SLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIA 519

  Fly   181 GVPKL-EMLLLNGNPLTWIAPTSLKSLS--NLRLLDMS--NCGPLPDLSLPGAHTL--------- 231
            |:|:: |.:.|.||.:|.:...:.|.|.  |||:||:|  ....||.....||..|         
  Fly   520 GLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNE 584

  Fly   232 ---ILDNS--GVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTA-TDIPKLLTGM 290
               :.|.|  |:|||::|   |..:.:.....|..|...:.:..|:|.||.|.| ||  ...:..
  Fly   585 LRQLKDTSFIGIQRLELL---HLQENQLGEADERALLPLAELRNLNLQSNKLEAITD--NFFSNN 644

  Fly   291 WRLQRLDLSENIIGIYAAAGSDNTSELFILP-----------------NLMYMNLSANRLTRLHF 338
            .||::||||.|:|...:....|....|..|.                 ||..::||.|:::|:..
  Fly   645 SRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGNLNNLRDIDLSYNQISRIQS 709

  Fly   339 DSPIPWERLTHLDASYNRIYAPAKVGIDEAFNLQSLHLEGNYINNFELTPWKPHPSLKEVALYDN 403
            |....|..:..:..|.|.|....:........||.|.|..|.|.|.|....|....|:|..|.||
  Fly   710 DVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADN 774

  Fly   404 KF-QPKGYKNITKFFNEIGVNVLEKTQYSQSNNTTP 438
            |. :.|.:     .|.|:...:....||::....:|
  Fly   775 KLVELKDH-----VFEELPSLLASHFQYNKLRYISP 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 5/17 (29%)
leucine-rich repeat 65..85 CDD:275380 6/19 (32%)
LRR_8 87..147 CDD:290566 16/59 (27%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI <131..334 CDD:238064 69/259 (27%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
LRR_8 140..195 CDD:290566 18/75 (24%)
leucine-rich repeat 161..184 CDD:275380 6/42 (14%)
leucine-rich repeat 185..208 CDD:275380 7/25 (28%)
leucine-rich repeat 209..246 CDD:275380 17/52 (33%)
leucine-rich repeat 247..267 CDD:275380 3/19 (16%)
leucine-rich repeat 268..292 CDD:275380 8/24 (33%)
leucine-rich repeat 293..322 CDD:275380 10/45 (22%)
leucine-rich repeat 395..406 CDD:275378 6/11 (55%)
atkNP_001262113.1 leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
LRR_8 183..244 CDD:290566
leucine-rich repeat 185..209 CDD:275380
LRR_4 209..247 CDD:289563
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
LRR_RI 250..492 CDD:238064 46/166 (28%)
LRR_8 259..318 CDD:290566
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380 5/9 (56%)
leucine-rich repeat 334..348 CDD:275378
LRR_8 358..418 CDD:290566 16/67 (24%)
leucine-rich repeat 360..383 CDD:275380 4/22 (18%)
leucine-rich repeat 384..407 CDD:275380 5/22 (23%)
LRR_8 406..466 CDD:290566 23/83 (28%)
leucine-rich repeat 408..431 CDD:275380 10/46 (22%)
leucine-rich repeat 432..455 CDD:275380 7/22 (32%)
LRR_RI 447..705 CDD:238064 69/262 (26%)
LRR_8 454..514 CDD:290566 13/59 (22%)
leucine-rich repeat 456..476 CDD:275380 7/19 (37%)
leucine-rich repeat 480..501 CDD:275380 5/20 (25%)
leucine-rich repeat 505..517 CDD:275378 0/11 (0%)
leucine-rich repeat 525..550 CDD:275380 7/24 (29%)
LRR_8 549..609 CDD:290566 19/62 (31%)
leucine-rich repeat 551..574 CDD:275380 9/22 (41%)
leucine-rich repeat 575..598 CDD:275380 4/22 (18%)
leucine-rich repeat 599..622 CDD:275380 5/25 (20%)
LRR_8 622..681 CDD:290566 19/60 (32%)
leucine-rich repeat 623..646 CDD:275380 8/24 (33%)
LRR_RI 647..896 CDD:238064 42/164 (26%)
leucine-rich repeat 647..670 CDD:275380 8/22 (36%)
leucine-rich repeat 671..693 CDD:275380 2/21 (10%)
leucine-rich repeat 694..717 CDD:275380 7/22 (32%)
LRR_8 716..776 CDD:290566 17/59 (29%)
leucine-rich repeat 718..741 CDD:275380 3/22 (14%)
leucine-rich repeat 742..763 CDD:275380 9/20 (45%)
LRR_8 765..824 CDD:290566 12/46 (26%)
leucine-rich repeat 766..789 CDD:275380 9/27 (33%)
leucine-rich repeat 790..813 CDD:275380 3/16 (19%)
leucine-rich repeat 814..835 CDD:275380
leucine-rich repeat 838..861 CDD:275380
LRR_8 862..921 CDD:290566
leucine-rich repeat 862..885 CDD:275380
leucine-rich repeat 886..906 CDD:275380
TPKR_C2 919..>946 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.