DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and caps

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster


Alignment Length:417 Identity:109/417 - (26%)
Similarity:185/417 - (44%) Gaps:62/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKLMPNLRTLELEN--CDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGN 121
            :.|.|.::.|.::|  ..:.|.:|....|   ||.|.|...::|.:.:..|:....::.|.|..|
  Fly    68 IALNPAIQRLVIKNNKLKTIDSSMQFYAQ---LTFLDLSFNDMLTIPERSFAYHAKLQELHLDHN 129

  Fly   122 NITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLE 186
            .|.::||:.|.||:.:.:|:|.||.|..|.:..|..:.:|..|:|..|||..:..:...|:..|.
  Fly   130 KIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLR 194

  Fly   187 MLLLNGNPLTWIAP----TSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLDILGSV 247
            :|.|:.|.||.:..    .:|.||:.|.|      |....:::||.  ...|..|:.|||:.|  
  Fly   195 VLYLDDNTLTTVPGELTFQALHSLAELYL------GTNSFMTIPGG--AFQDLKGLTRLDLRG-- 249

  Fly   248 HKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIP-KLLTGMWRLQRLDLSEN---IIGIYAA 308
                |..::|:...|....|:..|||..|.|.|  || .....:.||::|::.:|   :|...|.
  Fly   250 ----AGLHNISGDALKGLVSLRFLDLSDNRLPA--IPTAAFQRLGRLEQLNIGQNDFEVISSGAF 308

  Fly   309 AGSDNTSELFILPNLMYMNLS-ANRLTRLHFDSPIPWERLTHLDASYNR-IYAPAKVGIDEAFNL 371
            :|         |..|.::.|: |.||.|:...:......|.||:.|.|: :...:.:.:....:|
  Fly   309 SG---------LRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHL 364

  Fly   372 QSLHLEGNYINNFE--LTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSN 434
            .::.|:.|.:::.:  |.||   ..|:.:.|.:|.|             |....:|.......|.
  Fly   365 STVVLKANQLSSLDEGLVPW---ADLQTLDLSENPF-------------ECDCRLLWLRHLLVSR 413

  Fly   435 NTTPTCKPCI---PDA-RDFPTSISAD 457
            |.:....|.|   |.| ||.|.:..|:
  Fly   414 NASGQYAPVICAYPTALRDLPLAHLAE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 1/4 (25%)
leucine-rich repeat 65..85 CDD:275380 4/21 (19%)
LRR_8 87..147 CDD:290566 19/59 (32%)
leucine-rich repeat 89..112 CDD:275380 6/22 (27%)
leucine-rich repeat 113..136 CDD:275380 9/22 (41%)
LRR_RI <131..334 CDD:238064 61/211 (29%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
LRR_8 140..195 CDD:290566 18/54 (33%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
leucine-rich repeat 185..208 CDD:275380 9/26 (35%)
leucine-rich repeat 209..246 CDD:275380 10/36 (28%)
leucine-rich repeat 247..267 CDD:275380 3/19 (16%)
leucine-rich repeat 268..292 CDD:275380 8/24 (33%)
leucine-rich repeat 293..322 CDD:275380 7/31 (23%)
leucine-rich repeat 395..406 CDD:275378 3/10 (30%)
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 4/20 (20%)
LRR_8 96..155 CDD:290566 20/61 (33%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 9/22 (41%)
LRR_8 143..201 CDD:290566 17/57 (30%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR_RI 147..397 CDD:238064 74/277 (27%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
leucine-rich repeat 193..217 CDD:275380 7/23 (30%)
LRR_8 217..276 CDD:290566 21/72 (29%)
leucine-rich repeat 218..241 CDD:275380 7/30 (23%)
leucine-rich repeat 242..265 CDD:275380 7/28 (25%)
LRR_8 265..321 CDD:290566 19/66 (29%)
leucine-rich repeat 266..289 CDD:275380 8/24 (33%)
leucine-rich repeat 290..313 CDD:275380 7/31 (23%)
LRR_8 312..374 CDD:290566 14/61 (23%)
leucine-rich repeat 314..335 CDD:275380 6/20 (30%)
leucine-rich repeat 339..363 CDD:275380 5/23 (22%)
LRRCT 395..445 CDD:214507 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.