DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and trn

DIOPT Version :10

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:354 Identity:96/354 - (27%)
Similarity:144/354 - (40%) Gaps:89/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RTFSDKKATKLTEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQ--------LPYLTSL 92
            |||:.:|  ||.|.|::.                           |.:.|        |..:|.|
  Fly   100 RTFAYQK--KLQEVHLNH---------------------------NKIGQISNKTFIGLSAVTVL 135

  Fly    93 QLRRGNLLGLHDEHFSKWPNMKI--LMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDV- 154
            .||...:..||...|:  |.:||  |.||.|.|..|..:.|.||:||.:|.|..|.:..:|..| 
  Fly   136 NLRGNQISELHQGTFT--PLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVI 198

  Fly   155 FQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGP 219
            ||.:|.|..|.|..|.::::..:.|..:..|..|.|.|..|..|:..|...|..||:||:|    
  Fly   199 FQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLS---- 259

  Fly   220 LPDLSLPGAHTLILDNSGVQRLDILGSV--------HKLQARKNH---ITEIKLPDKSSVIELDL 273
                          ||    |||.:.||        .:|...:|.   |:|........:..|::
  Fly   260 --------------DN----RLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEV 306

  Fly   274 HSNLLTATDIPKLLTGMW----RLQRLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSANRLT 334
            :.    |..:.:::||.:    .|:.|:||.|.:.:....|:     |..|..|.::.|.||.||
  Fly   307 NG----ALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGA-----LSGLSQLKHVVLKANALT 362

  Fly   335 RLHFDSPIPWERLTHLDASYNRIYAPAKV 363
            .| .:...||:.|..||.|.|.:....:|
  Fly   363 SL-AEGLFPWKDLQTLDLSENPLSCDCRV 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/17 (18%)
leucine-rich repeat 65..85 CDD:275380 1/19 (5%)
LRR 68..482 CDD:443914 88/322 (27%)
leucine-rich repeat 89..112 CDD:275380 7/22 (32%)
leucine-rich repeat 113..136 CDD:275380 11/24 (46%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..246 CDD:275380 10/36 (28%)
leucine-rich repeat 247..267 CDD:275380 5/30 (17%)
leucine-rich repeat 268..292 CDD:275380 4/27 (15%)
leucine-rich repeat 293..322 CDD:275380 8/28 (29%)
leucine-rich repeat 395..406 CDD:275378
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR 82..406 CDD:443914 96/354 (27%)
leucine-rich repeat 84..107 CDD:275380 4/8 (50%)
leucine-rich repeat 108..131 CDD:275380 6/49 (12%)
leucine-rich repeat 132..155 CDD:275380 8/24 (33%)
leucine-rich repeat 156..179 CDD:275380 10/22 (45%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
leucine-rich repeat 253..276 CDD:275380 12/44 (27%)
leucine-rich repeat 277..300 CDD:275380 4/22 (18%)
leucine-rich repeat 301..322 CDD:275380 4/24 (17%)
leucine-rich repeat 326..350 CDD:275380 8/28 (29%)
leucine-rich repeat 351..373 CDD:275380 9/22 (41%)
LRRCT 382..434 CDD:214507 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.