DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and CG32055

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:341 Identity:84/341 - (24%)
Similarity:134/341 - (39%) Gaps:72/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSN 128
            |||.|.:.|.:..||....|..||.|..|.|....|..|....|...||:::|.:..||:..:..
  Fly   192 NLRFLSISNNNLRDFQWCHLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKR 256

  Fly   129 ECFKG---LAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLL 190
            ..|..   :|.|.||....|.::.|...||..|.:|..|:|..|:|..:|...|.|:..|:.|.|
  Fly   257 TLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHL 321

  Fly   191 NGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLD-------ILGSVH 248
            .||.::.:......:|:.|..||:|                   .:.:|:|.       ||..:.
  Fly   322 QGNKISILPDDVFANLTALEKLDLS-------------------KNNIQKLGLRVFGERILRKLI 367

  Fly   249 KLQARKNHITE---IKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAG 310
            .|....|:|.:   :.|.....:.||.|..|.|.:.|: ::...:.:||.|.::|          
  Fly   368 YLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDL-RMFAPLRQLQLLTINE---------- 421

  Fly   311 SDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRI-YAPAKVGIDEAFNLQSL 374
                                |||..:..:.....:||.||:.:.||: :.|..........|:::
  Fly   422 --------------------NRLEEIDGEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNI 466

  Fly   375 HLEGNYINNFELTPWK 390
            .||||        ||:
  Fly   467 TLEGN--------PWQ 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 84/341 (25%)
leucine-rich repeat 65..85 CDD:275380 7/19 (37%)
LRR_8 87..147 CDD:290566 18/62 (29%)
leucine-rich repeat 89..112 CDD:275380 6/22 (27%)
leucine-rich repeat 113..136 CDD:275380 4/25 (16%)
LRR_RI <131..334 CDD:238064 48/215 (22%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
LRR_8 140..195 CDD:290566 19/54 (35%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..246 CDD:275380 8/43 (19%)
leucine-rich repeat 247..267 CDD:275380 4/22 (18%)
leucine-rich repeat 268..292 CDD:275380 6/23 (26%)
leucine-rich repeat 293..322 CDD:275380 4/28 (14%)
leucine-rich repeat 395..406 CDD:275378
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..192 CDD:275380 84/341 (25%)
LRR_RI <187..400 CDD:238064 61/226 (27%)
LRR_8 192..251 CDD:290566 20/58 (34%)
leucine-rich repeat 193..216 CDD:275380 8/22 (36%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
leucine-rich repeat 241..267 CDD:275380 4/25 (16%)
leucine-rich repeat 268..291 CDD:275380 8/22 (36%)
LRR_8 290..350 CDD:290566 18/78 (23%)
leucine-rich repeat 292..315 CDD:275380 8/22 (36%)
leucine-rich repeat 316..339 CDD:275380 6/22 (27%)
LRR_8 340..400 CDD:290566 16/78 (21%)
leucine-rich repeat 340..365 CDD:275380 8/43 (19%)
leucine-rich repeat 366..389 CDD:275380 4/22 (18%)
leucine-rich repeat 390..413 CDD:275380 6/23 (26%)
LRR_8 391..448 CDD:290566 18/87 (21%)
leucine-rich repeat 414..437 CDD:275380 7/52 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.