DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and CG6749

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:449 Identity:121/449 - (26%)
Similarity:180/449 - (40%) Gaps:96/449 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PDLEDYCNDSYCHLLG-RSRTFSDKKATKLTEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMN 81
            |:|.. .|.|.|.|:. |...|:.:.|.:..:|..:..|........|||.|...|.........
  Fly   104 PNLRQ-LNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQC 167

  Fly    82 DLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNG 146
            ||..:|.|..|:|....|:   :..|...|.::.|:|..|.:.:|....|:||..|..|.|.||.
  Fly   168 DLPHMPLLNRLELGHNRLV---NATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNR 229

  Fly   147 IQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPK----LEMLLLNGNPLTWIAPTSLKSLS 207
            :..:..:.||.|.:|..|:||.|.::.|..|:|..|..    |:.|.|:||.:..:.....:.|:
  Fly   230 LSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLA 294

  Fly   208 NLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELD 272
            .|::||:|...   ..||..||.:     |      |||:.||..:.|.|.|||           
  Fly   295 RLQMLDVSRNS---IASLSPAHFV-----G------LGSLRKLYLQYNAILEIK----------- 334

  Fly   273 LHSNLLTATDIPKLLTGMWRLQRLDLS--------ENIIGIYAAAGSDNTSELFILPNLMYMNLS 329
                       |.....:..|..||||        |.|.|       .||     ||.:..:||:
  Fly   335 -----------PATFAALLNLDTLDLSYNNLEFLEEQIFG-------GNT-----LPRMRRLNLN 376

  Fly   330 ANRLTRLH---FDSPIPWERLTHLDASYN-------RIYAPAKVGIDEAFNLQSLHLEGNYINNF 384
            .||:..||   |.| :|:  |.:|...:|       |::||.:       .||.|||..|.:...
  Fly   377 GNRMKHLHPLAFSS-LPF--LEYLKLGHNELKSLDVRMFAPMR-------RLQKLHLGHNLLEEI 431

  Fly   385 ELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSNNTTPTCKPC 443
            .|...:...|::|: |.||        |...|..::.|:.....:.:...|  |...||
  Fly   432 NLDVLESLSSVQEI-LVDN--------NRLTFLAKVNVSFPNLKRVAIEGN--PWQCPC 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 2/17 (12%)
leucine-rich repeat 65..85 CDD:275380 6/19 (32%)
LRR_8 87..147 CDD:290566 19/59 (32%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI <131..334 CDD:238064 62/214 (29%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
LRR_8 140..195 CDD:290566 21/58 (36%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..246 CDD:275380 10/36 (28%)
leucine-rich repeat 247..267 CDD:275380 7/19 (37%)
leucine-rich repeat 268..292 CDD:275380 1/23 (4%)
leucine-rich repeat 293..322 CDD:275380 11/36 (31%)
leucine-rich repeat 395..406 CDD:275378 4/10 (40%)
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 45/155 (29%)
LRR_8 104..164 CDD:290566 16/60 (27%)
leucine-rich repeat 106..129 CDD:275380 7/23 (30%)
leucine-rich repeat 130..153 CDD:275380 4/22 (18%)
leucine-rich repeat 154..195 CDD:275380 10/43 (23%)
LRR_RI 194..455 CDD:238064 91/327 (28%)
LRR_8 194..254 CDD:290566 21/59 (36%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 21/72 (29%)
leucine-rich repeat 272..295 CDD:275380 6/22 (27%)
leucine-rich repeat 296..319 CDD:275380 10/36 (28%)
LRR_8 319..380 CDD:290566 24/94 (26%)
leucine-rich repeat 320..343 CDD:275380 8/44 (18%)
leucine-rich repeat 344..369 CDD:275380 11/36 (31%)
LRR_8 368..428 CDD:290566 22/69 (32%)
leucine-rich repeat 370..393 CDD:275380 8/23 (35%)
leucine-rich repeat 394..417 CDD:275380 6/29 (21%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.