DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and Lrt

DIOPT Version :10

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:410 Identity:111/410 - (27%)
Similarity:166/410 - (40%) Gaps:89/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GRSRTFSDK----------KATKLTEFHMDSCEKKVLKLMPNL---RTLELE-NCDSPD------ 77
            |:|::.|.|          ||.:::...:...:..:....||:   |..||| .||.|.      
  Fly    93 GKSKSTSGKYVNKSSPRKRKAEQVSSLPLPVDDALMEWKCPNITGTRNAELECGCDLPHTLRCNI 157

  Fly    78 ------FTMNDLNQLPYLTSL---QLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKG 133
                  ...:.|...||..||   .||  |:..|.|.......::..|::....|.|:....|.|
  Fly   158 DLHGMMLLADRLRTSPYSISLLDCSLR--NVTFLSDAKIFDNVSLHGLVISSGEIKRVHKSAFLG 220

  Fly   134 L-AQLWLLSLPGNGIQGLPWDV------------------------FQNLPELLHLDLSGNRIET 173
            : ..|..|.||||.:..:||:.                        |..|..|::|:||.|:|.:
  Fly   221 IRGPLQALGLPGNALMSVPWNALSTLSALERLDLANNKIKALGTADFVGLTSLVYLELSNNQISS 285

  Fly   174 LHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLS---NLRLLDM--SNC-GPLPDLSLPGAHTLI 232
            :.:..|..:.|||:|.|.||.|...| .||:|||   :||.||:  :|. |||.:.:|||...| 
  Fly   286 ISQRTFVNLRKLEVLKLGGNRLGDYA-QSLRSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNL- 348

  Fly   233 LDNSGVQRLDILGSVHKLQARKNHITEIK---LPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQ 294
                           ..|...:|.|..|:   |.:.|.::.|.|..|.:.... .....|:..|.
  Fly   349 ---------------ESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQ-DHAFFGLGALD 397

  Fly   295 RLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYA 359
            .||||.|.|...::|...:.|.|.:|      :|:.|.|..|..|...|...|..|..:.|.|..
  Fly   398 SLDLSYNGIVAISSASLQHLSRLTVL------DLTHNFLRALTSDLIAPLPSLRELRLAGNDISI 456

  Fly   360 PAKVGIDEAFNLQSLHLEGN 379
            .|:..:|.|..|:||.::.|
  Fly   457 VARNAMDGARELESLQMQEN 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 0/17 (0%)
leucine-rich repeat 65..85 CDD:275380 8/35 (23%)
LRR 68..482 CDD:443914 102/362 (28%)
leucine-rich repeat 89..112 CDD:275380 7/25 (28%)
leucine-rich repeat 113..136 CDD:275380 5/23 (22%)
leucine-rich repeat 137..160 CDD:275380 10/46 (22%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
leucine-rich repeat 185..208 CDD:275380 13/25 (52%)
leucine-rich repeat 209..246 CDD:275380 12/39 (31%)
leucine-rich repeat 247..267 CDD:275380 5/22 (23%)
leucine-rich repeat 268..292 CDD:275380 4/23 (17%)
leucine-rich repeat 293..322 CDD:275380 11/28 (39%)
leucine-rich repeat 395..406 CDD:275378
LrtNP_001286640.1 LRR 175..582 CDD:443914 93/328 (28%)
leucine-rich repeat 179..199 CDD:275378 5/21 (24%)
leucine-rich repeat 200..223 CDD:275380 5/22 (23%)
leucine-rich repeat 225..248 CDD:275380 8/22 (36%)
leucine-rich repeat 249..272 CDD:275380 2/22 (9%)
leucine-rich repeat 273..296 CDD:275380 7/22 (32%)
leucine-rich repeat 297..322 CDD:275380 13/25 (52%)
leucine-rich repeat 323..347 CDD:275380 11/23 (48%)
leucine-rich repeat 348..371 CDD:275380 6/38 (16%)
leucine-rich repeat 372..395 CDD:275380 4/23 (17%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
leucine-rich repeat 420..443 CDD:275380 8/28 (29%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.