DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and 18w

DIOPT Version :10

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster


Alignment Length:655 Identity:152/655 - (23%)
Similarity:229/655 - (34%) Gaps:231/655 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LASVSALGRPDLEDYCNDSYCHLLGRSRTFSD------KKATKLTEFHMDSCEKKVLKLMPNL-- 65
            |....|.||.||:  |:....|.       |:      ::..||:|..:|:|  |:.::.||.  
  Fly    58 LQVAEAAGRLDLQ--CSQELLHA-------SELAPGLFRQLQKLSELRIDAC--KLQRVPPNAFE 111

  Fly    66 --------------------RTLELEN---------------------------CDSP------- 76
                                :||||..                           |..|       
  Fly   112 GLMSLKRLTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNL 176

  Fly    77 ---------------------------------------DFTMNDLNQLP---------YLTSLQ 93
                                                   |.:.|:|..||         .|.:|.
  Fly   177 TQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLS 241

  Fly    94 LRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNL 158
            |:..|:..|.....:...::::|.:..|::..|.:|.|.|..:|..|.|.||.:..||..:...|
  Fly   242 LQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRL 306

  Fly   159 PELLHLDLSGNRIETLH--ENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSN--CGP 219
            .:||.||||||::.:.|  .:.|.|:.:|.:|.|:.|.||.|...:.|.|..|::|||.|  .|.
  Fly   307 EQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGH 371

  Fly   220 LPD---LSLPGAHTLILDNSGVQRLD--ILGSVH---KLQARKNHITEIK---LPDKSSVIELDL 273
            :.:   |.|...|||.|..:.:..||  |...::   ||....|.::.::   ..:.|.:.||||
  Fly   372 IEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDL 436

  Fly   274 HSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELF------------------IL 320
            .||.|  |::|:.:..:..|:.|||.||.|..:......|.::|.                  .|
  Fly   437 SSNQL--TEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDL 499

  Fly   321 PNLMYMNLSANRLTRLH---FDSPIPWERLTHLDASY----NRIYAPAK------------VGID 366
            |.|..:||:.||:..:.   ||.....|.: .||.::    |.|:|...            |..|
  Fly   500 PRLSVLNLAKNRIQSIERGAFDKNTEIEAI-RLDKNFLTDINGIFATLASLLWLNLSENHLVWFD 563

  Fly   367 EAF---NLQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKT 428
            .||   ||:.|.:.||||                          :...|..|...||.|..|:  
  Fly   564 YAFIPSNLKWLDIHGNYI--------------------------EALGNYYKLQEEIRVTTLD-- 600

  Fly   429 QYSQSNNTTPTCKPCIPDARDFPTSI-----------SADTNQTIDTKVNPLSNDTYQWNVWNVL 482
              :..|..|..      .|...|.||           ....|..:| |......|.|.    |||
  Fly   601 --ASHNRITEI------GAMSVPNSIELLFINNNIIGQIQANTFVD-KTRLARVDLYA----NVL 652

  Fly   483 MLVSL 487
            ..:||
  Fly   653 SKISL 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 5/17 (29%)
leucine-rich repeat 65..85 CDD:275380 9/114 (8%)
LRR 68..482 CDD:443914 130/561 (23%)
leucine-rich repeat 89..112 CDD:275380 5/22 (23%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 11/24 (46%)
leucine-rich repeat 185..208 CDD:275380 9/22 (41%)
leucine-rich repeat 209..246 CDD:275380 15/43 (35%)
leucine-rich repeat 247..267 CDD:275380 3/25 (12%)
leucine-rich repeat 268..292 CDD:275380 9/23 (39%)
leucine-rich repeat 293..322 CDD:275380 10/46 (22%)
leucine-rich repeat 395..406 CDD:275378 0/10 (0%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 6/33 (18%)
leucine-rich repeat 92..115 CDD:275380 7/24 (29%)
LRR_8 115..181 CDD:404697 6/65 (9%)
leucine-rich repeat 116..146 CDD:275380 4/29 (14%)
leucine-rich repeat 147..170 CDD:275380 1/22 (5%)
leucine-rich repeat 171..201 CDD:275380 0/29 (0%)
LRR 210..592 CDD:443914 109/410 (27%)
leucine-rich repeat 212..236 CDD:275380 5/23 (22%)
leucine-rich repeat 237..260 CDD:275380 5/22 (23%)
leucine-rich repeat 261..284 CDD:275380 6/22 (27%)
leucine-rich repeat 285..308 CDD:275380 8/22 (36%)
leucine-rich repeat 309..334 CDD:275380 11/24 (46%)
leucine-rich repeat 335..358 CDD:275380 9/22 (41%)
leucine-rich repeat 359..382 CDD:275380 8/22 (36%)
leucine-rich repeat 383..406 CDD:275380 7/22 (32%)
leucine-rich repeat 407..430 CDD:275380 3/22 (14%)
leucine-rich repeat 431..451 CDD:275380 9/21 (43%)
leucine-rich repeat 454..477 CDD:275380 8/22 (36%)
leucine-rich repeat 478..499 CDD:275380 1/20 (5%)
leucine-rich repeat 502..525 CDD:275380 7/22 (32%)
leucine-rich repeat 526..548 CDD:275380 6/22 (27%)
leucine-rich repeat 590..617 CDD:275380 8/36 (22%)
leucine-rich repeat 618..641 CDD:275380 4/23 (17%)
leucine-rich repeat 642..689 CDD:275380 7/20 (35%)
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.