DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and Toll-7

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster


Alignment Length:655 Identity:156/655 - (23%)
Similarity:245/655 - (37%) Gaps:217/655 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GRPDLEDYCNDSYCH-------LLGRSRTFSDKKATKLTEFHMDSCEKKVLKLMPN--------- 64
            |...|...|::.|..       :..|.:|        |....:|||  |:|:| ||         
  Fly   107 GSSQLTIQCSELYLFESTLPVAVFARLQT--------LEALRLDSC--KLLQL-PNNAFEGLATL 160

  Fly    65 --------------LRTLE--------LENCDSPDFTMNDLNQLP-------------YLTSLQL 94
                          .||||        |:.....|...|:|.|||             .||..::
  Fly   161 KSLRLSTHNSEWGPTRTLELFPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRI 225

  Fly    95 RRGNLLGLHDEH------------------------------FSKWPNMKILMLGGNNITRLSNE 129
            |....:|..|.:                              .|:...::.|.|..||::.||.|
  Fly   226 RTAEQMGFADMNCGAGSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGE 290

  Fly   130 CFKGLAQLWLLSLPGNGIQGLPWDVF------------QN------------LPELLHLDLSGNR 170
            ...|||.|.:::|..|.::.||..:|            ||            |.:||.:|||||:
  Fly   291 ALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQ 355

  Fly   171 IETLH--ENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSN--CGPLPD---LSLPGA 228
            :.:.|  ...|.|:.:|.:|.|..|.||.|...:.|.|..|::|::.|  .|.:.|   |.|...
  Fly   356 LTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNL 420

  Fly   229 HTLILDNSGVQRLDI-----LGSVHKLQARKNHITEIK---LPDKSSVIELDLHSNLLTATDIPK 285
            |||.|..:.:..||.     |..:.||....|.|:.::   ..:.|.:.||||.||.|  .::|:
  Fly   421 HTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQL--NEVPR 483

  Fly   286 LLTGMWRLQRLDLSENIIGIYAAAGSDNTS--ELFILPNLMYMNLSANRLTRLHF-DSPIPWERL 347
            .|..:..|:.|||.||.|..:     ||.|  .|..|..|..::.....:|...| |.|    ||
  Fly   484 ALQDLAMLRTLDLGENQIRTF-----DNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLP----RL 539

  Fly   348 THLDASYNRIYAPAKVGIDEAFNLQSLHLEGNY---INNFELT--------------PWKPH--- 392
            :.|:.:.|||.:..:...|:.|.|:::.|:.|:   ||....|              .|..:   
  Fly   540 SVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFDYAFI 604

  Fly   393 PS-LKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSNNTTPTCKPCIPDARDFPTSISA 456
            || ||.:.::.|..:..|  |..|...||.|..|                               
  Fly   605 PSNLKWLDIHGNYIEALG--NYYKLQEEIRVKTL------------------------------- 636

  Fly   457 DTNQTIDTKVNPLSNDTYQWNVWNVLMLVSLIVSLFVNSFLIVKLIRLRGRNQFTQSSSVPAIIE 521
            |.:....|::.|:|             :.:.|..||:|:.||..:    ..|.|...::: |.::
  Fly   637 DASHNRITEIGPMS-------------IPNTIELLFINNNLIGNV----QPNAFVDKANL-ARVD 683

  Fly   522 MFSNE 526
            :::|:
  Fly   684 LYANQ 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 7/17 (41%)
leucine-rich repeat 65..85 CDD:275380 8/27 (30%)
LRR_8 87..147 CDD:290566 20/102 (20%)
leucine-rich repeat 89..112 CDD:275380 6/52 (12%)
leucine-rich repeat 113..136 CDD:275380 9/22 (41%)
LRR_RI <131..334 CDD:238064 72/243 (30%)
leucine-rich repeat 137..160 CDD:275380 9/46 (20%)
LRR_8 140..195 CDD:290566 22/80 (28%)
leucine-rich repeat 161..184 CDD:275380 10/24 (42%)
leucine-rich repeat 185..208 CDD:275380 9/22 (41%)
leucine-rich repeat 209..246 CDD:275380 14/46 (30%)
leucine-rich repeat 247..267 CDD:275380 4/22 (18%)
leucine-rich repeat 268..292 CDD:275380 9/23 (39%)
leucine-rich repeat 293..322 CDD:275380 12/30 (40%)
leucine-rich repeat 395..406 CDD:275378 3/10 (30%)
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 17/76 (22%)
leucine-rich repeat 136..159 CDD:275380 9/25 (36%)
leucine-rich repeat 160..190 CDD:275380 5/29 (17%)
LRR_8 189..259 CDD:290566 11/69 (16%)
leucine-rich repeat 191..214 CDD:275380 6/22 (27%)
leucine-rich repeat 215..248 CDD:275380 5/32 (16%)
LRR_RI 247..501 CDD:238064 73/255 (29%)
LRR_8 247..308 CDD:290566 14/60 (23%)
leucine-rich repeat 249..273 CDD:275380 1/23 (4%)
leucine-rich repeat 274..297 CDD:275380 9/22 (41%)
LRR_8 297..356 CDD:290566 16/58 (28%)
leucine-rich repeat 298..321 CDD:275380 6/22 (27%)
leucine-rich repeat 322..345 CDD:275380 3/22 (14%)
LRR_8 345..406 CDD:290566 22/60 (37%)
leucine-rich repeat 346..371 CDD:275380 10/24 (42%)
leucine-rich repeat 372..395 CDD:275380 9/22 (41%)
leucine-rich repeat 396..419 CDD:275380 7/22 (32%)
LRR_8 419..478 CDD:290566 18/58 (31%)
leucine-rich repeat 420..443 CDD:275380 7/22 (32%)
leucine-rich repeat 444..467 CDD:275380 4/22 (18%)
LRR_RI 466..622 CDD:238064 47/166 (28%)
leucine-rich repeat 468..488 CDD:275380 9/21 (43%)
LRR_8 491..549 CDD:290566 21/66 (32%)
leucine-rich repeat 491..514 CDD:275380 11/27 (41%)
leucine-rich repeat 515..536 CDD:275380 4/20 (20%)
leucine-rich repeat 539..562 CDD:275380 6/22 (27%)
leucine-rich repeat 563..585 CDD:275380 6/21 (29%)
leucine-rich repeat 586..626 CDD:275380 8/41 (20%)
leucine-rich repeat 627..653 CDD:275380 8/69 (12%)
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.