DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and CG18480

DIOPT Version :10

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:220 Identity:57/220 - (25%)
Similarity:86/220 - (39%) Gaps:68/220 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 MKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHEN 177
            :::|.|..|:||.:.::.||....|..|:|..|.|..|..|.|..|..|.:||||.||:|.:.|:
  Fly    76 VELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEH 140

  Fly   178 IFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLD 242
            |.....:|..|.|.||.|                   |..|..|.|..|...:|.|.||.|.:|.
  Fly   141 ILESNNQLIHLNLEGNKL-------------------STLGKGPILRSPSLRSLNLRNSQVNQLG 186

  Fly   243 ILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYA 307
                                                     .:||:.:.:|::|||::|:: :..
  Fly   187 -----------------------------------------TQLLSALPQLRQLDLAQNLL-LTL 209

  Fly   308 AAGSDNTSELFILP-NLMYMNLSAN 331
            :.|.      |..| ||..:|:..|
  Fly   210 SPGD------FHAPRNLASLNVEEN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380
leucine-rich repeat 65..85 CDD:275380
LRR 68..482 CDD:443914 57/220 (26%)
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 10/22 (45%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..246 CDD:275380 11/36 (31%)
leucine-rich repeat 247..267 CDD:275380 0/19 (0%)
leucine-rich repeat 268..292 CDD:275380 2/23 (9%)
leucine-rich repeat 293..322 CDD:275380 8/29 (28%)
leucine-rich repeat 395..406 CDD:275378
CG18480NP_609761.1 LRR <66..>230 CDD:443914 57/220 (26%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
leucine-rich repeat 124..147 CDD:275380 10/22 (45%)
leucine-rich repeat 148..171 CDD:275380 10/41 (24%)
leucine-rich repeat 172..195 CDD:275380 8/63 (13%)
leucine-rich repeat 196..219 CDD:275380 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.