DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and CG18480

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:220 Identity:57/220 - (25%)
Similarity:86/220 - (39%) Gaps:68/220 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 MKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHEN 177
            :::|.|..|:||.:.::.||....|..|:|..|.|..|..|.|..|..|.:||||.||:|.:.|:
  Fly    76 VELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEH 140

  Fly   178 IFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLD 242
            |.....:|..|.|.||.|                   |..|..|.|..|...:|.|.||.|.:|.
  Fly   141 ILESNNQLIHLNLEGNKL-------------------STLGKGPILRSPSLRSLNLRNSQVNQLG 186

  Fly   243 ILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYA 307
                                                     .:||:.:.:|::|||::|:: :..
  Fly   187 -----------------------------------------TQLLSALPQLRQLDLAQNLL-LTL 209

  Fly   308 AAGSDNTSELFILP-NLMYMNLSAN 331
            :.|.      |..| ||..:|:..|
  Fly   210 SPGD------FHAPRNLASLNVEEN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380
leucine-rich repeat 65..85 CDD:275380
LRR_8 87..147 CDD:290566 11/33 (33%)
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI <131..334 CDD:238064 52/202 (26%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
LRR_8 140..195 CDD:290566 23/54 (43%)
leucine-rich repeat 161..184 CDD:275380 10/22 (45%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
leucine-rich repeat 209..246 CDD:275380 11/36 (31%)
leucine-rich repeat 247..267 CDD:275380 0/19 (0%)
leucine-rich repeat 268..292 CDD:275380 2/23 (9%)
leucine-rich repeat 293..322 CDD:275380 8/29 (28%)
leucine-rich repeat 395..406 CDD:275378
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 22/57 (39%)
LRR_RI <76..230 CDD:238064 57/220 (26%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR_8 122..182 CDD:290566 25/78 (32%)
leucine-rich repeat 124..147 CDD:275380 10/22 (45%)
leucine-rich repeat 148..171 CDD:275380 10/41 (24%)
LRR_8 170..230 CDD:290566 21/107 (20%)
leucine-rich repeat 172..195 CDD:275380 8/63 (13%)
leucine-rich repeat 196..219 CDD:275380 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.