DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and IGFALS

DIOPT Version :10

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001139478.1 Gene:IGFALS / 3483 HGNCID:5468 Length:643 Species:Homo sapiens


Alignment Length:474 Identity:126/474 - (26%)
Similarity:186/474 - (39%) Gaps:111/474 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKI 115
            :.|.|.:.|..:.||..|.||........:......|.|.||.|....|..|.|..|....::..
Human   148 LGSLEPQALLGLENLCHLHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWD 212

  Fly   116 LMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFT 180
            |.||.|::..|.:..|:||..|..|.|.||.:..|...:|..|.||..||||.|.:..:..|:|.
Human   213 LNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFV 277

  Fly   181 GVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSN---CGPLPDLSLPG---------AHTLI- 232
            .:|:|:.|.|:.|.:..:||.:...|..||.||:|:   .|.|.| :.||         :|..| 
Human   278 QLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLED-TFPGLLGLRVLRLSHNAIA 341

  Fly   233 -----------------LDNSGVQRL-----DILGSVHKLQARKNHITEIK-------------- 261
                             |.::.:::|     :.||.:..|....|.:.|:|              
Human   342 SLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMN 406

  Fly   262 --------LPDKSSVIELDLHSNLLTATDI----PKLLTGMWRLQRLDLSEN-IIGIYAAA---- 309
                    ||::.......|||..|..:.:    |...||:..|:||.|.:| ::||...:    
Human   407 LSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGL 471

  Fly   310 ----GSDNTS-ELFILPN--------LMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYAPA 361
                ..|.|| :|..||:        |.|:.||.|||..|..|:..|.:|...||.|:||:.|..
Human   472 AELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVSHNRLEALP 536

  Fly   362 KVGIDEAFNLQSLHLEGNYINNF------------ELTPWK---PHPSLKEVALYDNKFQPK--- 408
            ...:.....|:.|.|..|.:..|            |..||.   |..:|::.||.:....|:   
Human   537 NSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDCGCPLKALRDFALQNPSAVPRFVQ 601

  Fly   409 -------------GYKNIT 414
                         .|.|||
Human   602 AICEGDDCQPPAYTYNNIT 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/12 (25%)
leucine-rich repeat 65..85 CDD:275380 4/19 (21%)
LRR 68..482 CDD:443914 121/457 (26%)
leucine-rich repeat 89..112 CDD:275380 8/22 (36%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..246 CDD:275380 15/71 (21%)
leucine-rich repeat 247..267 CDD:275380 6/41 (15%)
leucine-rich repeat 268..292 CDD:275380 7/27 (26%)
leucine-rich repeat 293..322 CDD:275380 12/38 (32%)
leucine-rich repeat 395..406 CDD:275378 3/10 (30%)
IGFALSNP_001139478.1 LRRNT 78..116 CDD:214470
leucine-rich repeat 95..113 CDD:275380
leucine-rich repeat 114..137 CDD:275380
LRR 132..574 CDD:443914 115/426 (27%)
leucine-rich repeat 138..161 CDD:275380 3/12 (25%)
leucine-rich repeat 162..185 CDD:275380 4/22 (18%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..233 CDD:275380 8/22 (36%)
leucine-rich repeat 234..257 CDD:275380 8/22 (36%)
leucine-rich repeat 258..281 CDD:275380 8/22 (36%)
leucine-rich repeat 282..305 CDD:275380 7/22 (32%)
leucine-rich repeat 306..324 CDD:275380 8/18 (44%)
leucine-rich repeat 354..377 CDD:275380 3/22 (14%)
leucine-rich repeat 378..401 CDD:275380 4/22 (18%)
leucine-rich repeat 402..423 CDD:275380 2/20 (10%)
leucine-rich repeat 426..447 CDD:275380 6/20 (30%)
leucine-rich repeat 450..473 CDD:275380 7/22 (32%)
leucine-rich repeat 474..497 CDD:275380 6/22 (27%)
leucine-rich repeat 498..519 CDD:275380 9/20 (45%)
leucine-rich repeat 522..543 CDD:275380 6/20 (30%)
leucine-rich repeat 546..565 CDD:275380 5/18 (28%)
LRRCT 574..618 CDD:214507 8/43 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.