DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and kek5

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster


Alignment Length:564 Identity:113/564 - (20%)
Similarity:183/564 - (32%) Gaps:214/564 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLIIIALLASVSAL-----GRPDLEDYCNDSYCHLLGRSRTFSDKKATKLTEFHMDSCEKKVLK 60
            |.|:::.:|..:.||     |..|....|...:|      :..|.||:.        .|:.|.|.
  Fly    15 MILLLLGVLVVLMALPPPTAGTTDWMQSCGTCHC------QWNSGKKSA--------DCKNKALT 65

  Fly    61 LMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLL--GLHDEHFSKWPNMKILMLGGNNI 123
            .:|...:.|::..|...      ||:|     :|||...|  ||        ||:..:.|....|
  Fly    66 KIPQDMSNEMQVLDFAH------NQIP-----ELRREEFLLAGL--------PNVHKIFLRNCTI 111

  Fly   124 TRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEML 188
            ..:..|.|||                        |..|:.||||||||..||...|.|:.||..:
  Fly   112 QEVHREAFKG------------------------LHILIELDLSGNRIRELHPGTFAGLEKLRNV 152

  Fly   189 LLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKLQAR 253
            ::|.|.:..:......:||.|..::..| ..|..:.|   |..    :|..   .|.::...|.|
  Fly   153 IINNNEIEVLPNHLFVNLSFLSRIEFRN-NRLRQVQL---HVF----AGTM---ALSAISLEQNR 206

  Fly   254 KNHITEIKLPDKSSVIELDLHSN-------------------LLT-ATDI---PKLLTGMWRLQR 295
            .:|:.:....|...::.|.|..|                   |.| .||.   |:|...:|    
  Fly   207 LSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRLYTPPTDCQEPPQLRGKLW---- 267

  Fly   296 LDLSENIIGIYAAAGSDNTSELFIL-PNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYA 359
                           |:..||.|.. |.:    |.:.|               :.::|:::.|..
  Fly   268 ---------------SEVPSENFACRPRI----LGSVR---------------SFIEANHDNISL 298

  Fly   360 PAKV------GIDEAFN---LQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITK 415
            |.::      .:...:|   ||........:.:.|..|.:|...|                  |.
  Fly   299 PCRIVGSPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVL------------------TS 345

  Fly   416 FFNEIGVNVLEKTQYSQSNNTTPTCKPCIPDAR--------------DFPTSISADTNQ------ 460
            ....:||...:|..|:           |:.|.|              |:..::||....      
  Fly   346 ELRIVGVRASDKGAYT-----------CVADNRGGRAEAEFQLLVSGDYAGAVSASDGMGMGAIG 399

  Fly   461 --TIDTKVNPLSNDTYQWNVWNVLMLVSLIVSLFVNSFLIVKLI 502
              |||.:.|                 :.||:.|.:.:.|::.|:
  Fly   400 APTIDPQTN-----------------MFLIICLIITTLLLLLLV 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/17 (18%)
leucine-rich repeat 65..85 CDD:275380 2/19 (11%)
LRR_8 87..147 CDD:290566 15/61 (25%)
leucine-rich repeat 89..112 CDD:275380 6/24 (25%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
LRR_RI <131..334 CDD:238064 51/226 (23%)
leucine-rich repeat 137..160 CDD:275380 1/22 (5%)
LRR_8 140..195 CDD:290566 18/54 (33%)
leucine-rich repeat 161..184 CDD:275380 13/22 (59%)
leucine-rich repeat 185..208 CDD:275380 4/22 (18%)
leucine-rich repeat 209..246 CDD:275380 7/36 (19%)
leucine-rich repeat 247..267 CDD:275380 4/19 (21%)
leucine-rich repeat 268..292 CDD:275380 9/46 (20%)
leucine-rich repeat 293..322 CDD:275380 4/29 (14%)
leucine-rich repeat 395..406 CDD:275378 1/10 (10%)
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 36/126 (29%)
leucine-rich repeat 76..100 CDD:275380 10/42 (24%)
LRR_8 99..159 CDD:290566 26/83 (31%)
leucine-rich repeat 101..124 CDD:275380 7/46 (15%)
LRR 122..145 CDD:197688 13/22 (59%)
leucine-rich repeat 125..148 CDD:275380 13/22 (59%)
LRR_8 148..207 CDD:290566 14/69 (20%)
leucine-rich repeat 149..172 CDD:275380 4/22 (18%)
leucine-rich repeat 173..196 CDD:275380 6/33 (18%)
LRR_8 197..>229 CDD:290566 7/31 (23%)
leucine-rich repeat 197..220 CDD:275380 5/22 (23%)
LRRCT 229..277 CDD:214507 12/66 (18%)
Ig 296..376 CDD:143165 17/108 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.