DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7800 and Nrros

DIOPT Version :9

Sequence 1:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001020166.1 Gene:Nrros / 303875 RGDID:1310771 Length:692 Species:Rattus norvegicus


Alignment Length:382 Identity:94/382 - (24%)
Similarity:151/382 - (39%) Gaps:104/382 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKLMPNLRTLELENCD---SPDFTMNDLNQLPYL-------------------TSLQLRRGNLLG 101
            |:..|.|..|.|.:|.   ...:..::...|..|                   |.|:|||.:|.|
  Rat    77 LQAYPRLEDLSLHSCHLDRISHWAFHEQGHLQNLVLADNRLSENYKESATALHTLLRLRRLDLSG 141

  Fly   102 ---------LHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQN 157
                     |..::.|   :::::.|..|.:.||.:..|:||.:|..|.|..|.|..:....|..
  Rat   142 NSLTEDMAALMLQNLS---SLEVVSLARNTLMRLDDSVFEGLERLVELDLQRNYIFEIEGGAFDG 203

  Fly   158 LPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSN------ 216
            |.||..|:|:.|.:..:.:...|   :|..|.::.|.|.|......::...|.:||:|:      
  Rat   204 LTELRRLNLAYNNLPCIVDFSLT---QLRFLNVSYNILEWFLAAREEAAFELEILDLSHNQLLFF 265

  Fly   217 -----CGPLPDLSLPGAHTLIL-DNS-GVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELDLH 274
                 ||.|        |||:| ||| |..|     .::...:.:..:.:..|.|          
  Rat   266 PLLPQCGKL--------HTLLLQDNSMGFYR-----ELYNTSSPQEMVAQFLLVD---------- 307

  Fly   275 SNLLTATDIPKLLTGMWR---------LQRLDLSENIIGIYAAAGSDNTSELFI--LPNLMYMNL 328
            .|:...|.:     .:|.         |:.||:|:|.:        .:..:.|:  .|:|.::||
  Rat   308 GNVTNITTV-----SLWEEFSSSDLSALRFLDMSQNQL--------RHLPDGFLKKTPSLSHLNL 359

  Fly   329 SANRLTRLHFDSPIPWERLTHLDASYNRI----YAPAKVGIDE---AFNLQSLHLEG 378
            :.|.||:||.....|...||.||.|.|::    .||...|..:   .|||.|..|.|
  Rat   360 NQNCLTKLHIREHEPPGALTELDLSRNQLAELHLAPGLTGSLKNLRVFNLSSNQLLG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 1/4 (25%)
leucine-rich repeat 65..85 CDD:275380 4/22 (18%)
LRR_8 87..147 CDD:290566 21/87 (24%)
leucine-rich repeat 89..112 CDD:275380 10/50 (20%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI <131..334 CDD:238064 53/226 (23%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
LRR_8 140..195 CDD:290566 15/54 (28%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..208 CDD:275380 5/22 (23%)
leucine-rich repeat 209..246 CDD:275380 16/49 (33%)
leucine-rich repeat 247..267 CDD:275380 2/19 (11%)
leucine-rich repeat 268..292 CDD:275380 2/23 (9%)
leucine-rich repeat 293..322 CDD:275380 6/30 (20%)
leucine-rich repeat 395..406 CDD:275378
NrrosNP_001020166.1 leucine-rich repeat 39..57 CDD:275380
LRR 1. /evidence=ECO:0000255 58..79 1/1 (100%)
leucine-rich repeat 60..82 CDD:275380 1/4 (25%)
LRR 2. /evidence=ECO:0000255 82..103 4/20 (20%)
leucine-rich repeat 83..106 CDD:275380 4/22 (18%)
LRR 3. /evidence=ECO:0000255 106..127 2/20 (10%)
leucine-rich repeat 107..158 CDD:275380 11/53 (21%)
LRR 4. /evidence=ECO:0000255 133..155 6/21 (29%)
LRR_8 157..217 CDD:290566 20/62 (32%)
LRR 5. /evidence=ECO:0000255 158..179 5/20 (25%)
leucine-rich repeat 159..182 CDD:275380 7/22 (32%)
LRR 6. /evidence=ECO:0000255 182..203 6/20 (30%)
leucine-rich repeat 183..206 CDD:275380 7/22 (32%)
LRR 7. /evidence=ECO:0000255 206..227 6/23 (26%)
leucine-rich repeat 207..251 CDD:275380 10/46 (22%)
LRR 8. /evidence=ECO:0000255 228..239 3/10 (30%)
LRR 9. /evidence=ECO:0000255 251..272 4/20 (20%)
leucine-rich repeat 252..273 CDD:275380 5/20 (25%)
LRR 10. /evidence=ECO:0000255 273..294 10/33 (30%)
leucine-rich repeat 274..329 CDD:275380 15/82 (18%)
LRR_RI 328..549 CDD:238064 31/97 (32%)
LRR 11. /evidence=ECO:0000255 329..350 6/28 (21%)
LRR_8 330..388 CDD:290566 22/65 (34%)
leucine-rich repeat 330..353 CDD:275380 6/30 (20%)
LRR 12. /evidence=ECO:0000255 353..374 8/20 (40%)
leucine-rich repeat 354..377 CDD:275380 9/22 (41%)
LRR 13. /evidence=ECO:0000255 377..398 8/20 (40%)
LRR_8 378..438 CDD:290566 15/39 (38%)
leucine-rich repeat 378..403 CDD:275380 9/24 (38%)
LRR 14. /evidence=ECO:0000255 403..424 6/14 (43%)
leucine-rich repeat 404..427 CDD:275380 6/13 (46%)
LRR 15. /evidence=ECO:0000255 427..448
leucine-rich repeat 428..463 CDD:275380
LRR_8 463..548 CDD:290566
LRR 16. /evidence=ECO:0000255 463..484
leucine-rich repeat 464..486 CDD:275380
LRR 17. /evidence=ECO:0000255 486..507
leucine-rich repeat 487..512 CDD:275380
LRR 18. /evidence=ECO:0000255 512..533
leucine-rich repeat 513..537 CDD:275380
LRR_8 537..595 CDD:290566
LRR_4 537..574 CDD:289563
LRR 19. /evidence=ECO:0000255 537..558
leucine-rich repeat 538..559 CDD:275380
LRR 20. /evidence=ECO:0000255 559..580
LRR 21. /evidence=ECO:0000255 585..605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.