Sequence 1: | NP_649770.1 | Gene: | CG7800 / 40963 | FlyBaseID: | FBgn0037552 | Length: | 533 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_443204.1 | Gene: | LRG1 / 116844 | HGNCID: | 29480 | Length: | 347 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 59/198 - (29%) |
---|---|---|---|
Similarity: | 79/198 - (39%) | Gaps: | 43/198 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 ATKLTEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHF 107
Fly 108 SKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIE 172
Fly 173 TLHENIFTG------------------------VPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLD 213
Fly 214 MSN 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7800 | NP_649770.1 | leucine-rich repeat | 46..64 | CDD:275380 | 4/17 (24%) |
leucine-rich repeat | 65..85 | CDD:275380 | 6/19 (32%) | ||
LRR_8 | 87..147 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | <131..334 | CDD:238064 | 34/110 (31%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 140..195 | CDD:290566 | 23/78 (29%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 9/46 (20%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 209..246 | CDD:275380 | 5/8 (63%) | ||
leucine-rich repeat | 247..267 | CDD:275380 | |||
leucine-rich repeat | 268..292 | CDD:275380 | |||
leucine-rich repeat | 293..322 | CDD:275380 | |||
leucine-rich repeat | 395..406 | CDD:275378 | |||
LRG1 | NP_443204.1 | LRR_8 | 79..128 | CDD:290566 | 17/55 (31%) |
LRR_RI | <82..248 | CDD:238064 | 51/175 (29%) | ||
LRR 1 | 93..114 | 11/39 (28%) | |||
leucine-rich repeat | 94..117 | CDD:275380 | 10/41 (24%) | ||
LRR_8 | 116..176 | CDD:290566 | 20/59 (34%) | ||
LRR 2 | 117..138 | 8/20 (40%) | |||
leucine-rich repeat | 118..141 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 141..162 | 4/20 (20%) | |||
leucine-rich repeat | 142..165 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 165..186 | 7/20 (35%) | |||
leucine-rich repeat | 166..189 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 169..224 | CDD:290566 | 16/54 (30%) | ||
LRR 5 | 189..210 | 8/20 (40%) | |||
leucine-rich repeat | 190..213 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 213..272 | CDD:290566 | 15/57 (26%) | ||
LRR 6 | 213..234 | 0/20 (0%) | |||
leucine-rich repeat | 214..237 | CDD:275380 | 0/22 (0%) | ||
LRR 7 | 237..258 | 8/20 (40%) | |||
leucine-rich repeat | 238..261 | CDD:275380 | 9/22 (41%) | ||
LRR 8 | 261..282 | 5/9 (56%) | |||
leucine-rich repeat | 262..285 | CDD:275380 | 5/8 (63%) | ||
LRRCT | 299..346 | CDD:214507 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45617 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |