DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and ECM23

DIOPT Version :10

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_015304.1 Gene:ECM23 / 856086 SGDID:S000005942 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:118 Identity:31/118 - (26%)
Similarity:48/118 - (40%) Gaps:33/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 LGG-----SVGGTAGMGSMSGNSGGAGSLSGHSGAGSNAGSNCLDVKPVRTKPRT---SAEGREC 474
            |||     |:.......|:..:|.|..||:|:              :|...|.:|   :.:.:||
Yeast    82 LGGPLHNPSILPAPSFSSLPISSNGKKSLAGY--------------RPKSRKKQTILPNGQPKEC 132

  Fly   475 VNCGATSTPLWRRDGTGHY-LCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSA 526
            ..||.|.|..||....|:. ||:.||:.|          :.|....::|.||:
Yeast   133 ATCGDTWTSQWRSGPNGNVELCSRCGIAY----------RKKMEKKIRSQQSS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 473..517 CDD:238123 15/44 (34%)
ZnF_GATA 533..583 CDD:238123
ECM23NP_015304.1 ZnF_GATA 127..178 CDD:214648 18/59 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.