DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and GZF3

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_012425.1 Gene:GZF3 / 853334 SGDID:S000003646 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:54/182 - (29%)
Similarity:79/182 - (43%) Gaps:32/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 SSSGLHGLG-----GSVGGTAGMG--SMSGNSGGAGSLSGHSGAGSNAGSNCLDVKPVRTKPRTS 468
            ||..|:.|.     |.:|....:|  ::|.....|..|. .|.||::. ||.::.|.......||
Yeast    24 SSENLNSLNQSEEEGHIGRWPPLGYEAVSAEQKSAVQLR-ESQAGASI-SNNMNFKANDKSFSTS 86

  Fly   469 AEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTS 533
            ..||...:..:....|.:..             .|.|||.         :......:.:..|...
Yeast    87 TAGRMSPDTNSLHHILPKNQ-------------VKNNGQT---------MDANCNNNVSNDANVP 129

  Fly   534 -CANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRK 584
             |.||.|:||.||||:..|..:||||||:.|||...||:::|.:.|::||||
Yeast   130 VCKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKSRNRK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 7/46 (15%)
ZnF_GATA 473..517 CDD:238123 5/43 (12%)
ZnF_GATA 529..578 CDD:214648 24/49 (49%)
ZnF_GATA 533..583 CDD:238123 25/50 (50%)
GZF3NP_012425.1 GAT1 4..551 CDD:227928 54/182 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 1 1.000 - - mtm9213
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1745
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.