DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and ZML2

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_564593.1 Gene:ZML2 / 841585 AraportID:AT1G51600 Length:302 Species:Arabidopsis thaliana


Alignment Length:104 Identity:36/104 - (34%)
Similarity:47/104 - (45%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 MSGNSGGAGSLSGH----SGAGSNAGSNCLDVKPVRTKPRTSAEGR----ECVNC--GATSTPLW 485
            |..|.|...|...:    :.|||:.|||       :|....|:|.:    .|.:|  |..|||:.
plant   179 MQRNKGQFTSAKSNNDEAASAGSSWGSN-------QTWAIESSEAQHQEISCRHCGIGEKSTPMM 236

  Fly   486 RRDGTG-HYLCNACGLYYKMNGQNRPLIKPKRRLTLQSL 523
            ||...| ..|||||||.:...|..|.|.|...: |.|:|
plant   237 RRGPAGPRTLCNACGLMWANKGAFRDLSKASPQ-TAQNL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 21/53 (40%)
ZnF_GATA 473..517 CDD:238123 20/46 (43%)
ZnF_GATA 529..578 CDD:214648
ZnF_GATA 533..583 CDD:238123
ZML2NP_564593.1 tify 78..111 CDD:399304
CCT 147..190 CDD:399306 4/10 (40%)
ZnF_GATA 222..>265 CDD:238123 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.