DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and ARR4

DIOPT Version :10

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_172517.1 Gene:ARR4 / 837587 AraportID:AT1G10470 Length:259 Species:Arabidopsis thaliana


Alignment Length:98 Identity:23/98 - (23%)
Similarity:36/98 - (36%) Gaps:28/98 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SFPFPPTPPKDSTPDSVQTGPSEYQAVMNAFMHQQATGSTSLTDASCALDIKPSIQNGSASGSSG 243
            |.| ||:||...:|:|                      |..||.::.:.|..|.:     |....
plant   185 SLP-PPSPPLTISPES----------------------SPPLTVSTESSDSSPPL-----SPVEI 221

  Fly   244 SGTTHTSTPKQREGTASTTNSSSNSSSSQQQQQ 276
            ..|:..|:|...|.....|:||..|...:|:.:
plant   222 FSTSPLSSPIDDEDDDVLTSSSEESPIRRQKMR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 473..517 CDD:238123
ZnF_GATA 533..583 CDD:238123
ARR4NP_172517.1 REC_typeA_ARR 36..157 CDD:381119
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.