DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and GATA11

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001077485.1 Gene:GATA11 / 837316 AraportID:AT1G08010 Length:303 Species:Arabidopsis thaliana


Alignment Length:231 Identity:55/231 - (23%)
Similarity:84/231 - (36%) Gaps:91/231 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 SYASYHHAAAHHQAAA---VAAANMFQSSSVAAAAVRHSMAAAQAHHHHHHHHSGHHHSGSSSGL 415
            ||:|...::..||::|   :..:.:|||.|..                                 
plant    92 SYSSEALSSTLHQSSAPPEIKVSKLFQSLSPV--------------------------------- 123

  Fly   416 HGLGGSVGGTAGMGSMSGNSGGAGSLSGHSGAGSNAGSNCL--DVKPVRTK---PRT-------S 468
                          |:..||  .||||.|     |.||..|  .||.:|:|   |.|       .
plant   124 --------------SVLENS--YGSLSTH-----NNGSQRLAFPVKGMRSKRKRPTTLRLSYLFP 167

  Fly   469 AEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGT- 532
            :|.|:    ...|||     |.....|     |:  :.:.....|.|..||.:::.|..:.:.: 
plant   168 SEPRK----PEKSTP-----GKPESEC-----YF--SSEQHAKKKRKIHLTTRTVSSTLEASNSD 216

  Fly   533 ----SCANCKTTTTTLWRRNASG-EPVCNACGLYYK 563
                .|.:|:||.|..||...|| :.:|||||:.::
plant   217 GIVRKCTHCETTKTPQWREGPSGPKTLCNACGVRFR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 10/46 (22%)
ZnF_GATA 473..517 CDD:238123 8/43 (19%)
ZnF_GATA 529..578 CDD:214648 14/41 (34%)
ZnF_GATA 533..583 CDD:238123 14/32 (44%)
GATA11NP_001077485.1 ZnF_GATA 217..270 CDD:214648 14/36 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.