DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and RR23

DIOPT Version :10

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_201018.1 Gene:RR23 / 836332 AraportID:AT5G62120 Length:145 Species:Arabidopsis thaliana


Alignment Length:72 Identity:20/72 - (27%)
Similarity:29/72 - (40%) Gaps:22/72 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 PLWRRD-GTGHYLCNACGLYYKMNGQN-----------------RPLIKPKRRLT--LQ-SLQSA 526
            |:.||| .:.:.:|.. .|.::|||:.                 |...|||.:.|  || ...||
plant    72 PISRRDLNSLNVVCQQ-ALRHRMNGETNLNGSGQNVTDDPDDWLRLREKPKLKWTKPLQHRFMSA 135

  Fly   527 AKRAGTS 533
            .|..|.:
plant   136 LKSLGVA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 473..517 CDD:238123 13/51 (25%)
ZnF_GATA 533..583 CDD:238123 0/1 (0%)
RR23NP_201018.1 CheY <17..78 CDD:440547 3/5 (60%)

Return to query results.
Submit another query.