DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and GATA9

DIOPT Version :10

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_195015.1 Gene:GATA9 / 829425 AraportID:AT4G32890 Length:308 Species:Arabidopsis thaliana


Alignment Length:48 Identity:21/48 - (43%)
Similarity:27/48 - (56%) Gaps:2/48 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 SAEGRECVNCGATSTPLWRRDGTG-HYLCNACGLYYKMNGQNRPLIKP 514
            |..||.|::|....||.||....| ..||||||:.|| :|:..|..:|
plant   193 SGGGRRCLHCATEKTPQWRTGPMGPKTLCNACGVRYK-SGRLVPEYRP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 473..517 CDD:238123 18/43 (42%)
ZnF_GATA 533..583 CDD:238123
GATA9NP_195015.1 ZnF_GATA 194..246 CDD:214648 20/47 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.