| Sequence 1: | NP_001262366.1 | Gene: | grn / 40962 | FlyBaseID: | FBgn0001138 | Length: | 712 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_195015.1 | Gene: | GATA9 / 829425 | AraportID: | AT4G32890 | Length: | 308 | Species: | Arabidopsis thaliana |
| Alignment Length: | 48 | Identity: | 21/48 - (43%) |
|---|---|---|---|
| Similarity: | 27/48 - (56%) | Gaps: | 2/48 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 468 SAEGRECVNCGATSTPLWRRDGTG-HYLCNACGLYYKMNGQNRPLIKP 514 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| grn | NP_001262366.1 | ZnF_GATA | 473..517 | CDD:238123 | 18/43 (42%) |
| ZnF_GATA | 533..583 | CDD:238123 | |||
| GATA9 | NP_195015.1 | ZnF_GATA | 194..246 | CDD:214648 | 20/47 (43%) |
| Blue background indicates that the domain is not in the aligned region. | |||||