DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and ZIM

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001190821.1 Gene:ZIM / 828549 AraportID:AT4G24470 Length:317 Species:Arabidopsis thaliana


Alignment Length:131 Identity:39/131 - (29%)
Similarity:55/131 - (41%) Gaps:26/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 MSGNSGGAGSLSGHSGAGSNAGSNCLDVKPVRTKPRTSAEGRECVNCGATS--TPLWRRDGTG-H 492
            |:.|.|...|.....|| .|:|:: .|.......|..|     |.:||.:|  ||:.||..:| .
plant   178 MARNKGQFTSSKMTDGA-YNSGTD-QDSAQDDAHPEIS-----CTHCGISSKCTPMMRRGPSGPR 235

  Fly   493 YLCNACGLYYKMNGQNRPLIK--PKRRLTLQ--------------SLQSAAKRAGTSCANCKTTT 541
            .|||||||::...|..|.|.|  .:.:|.|.              |:..||....|..|:.:..|
plant   236 TLCNACGLFWANRGTLRDLSKKTEENQLALMKPVSSYKYHPDDGGSVADAANNLNTEAASVEEHT 300

  Fly   542 T 542
            :
plant   301 S 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 20/51 (39%)
ZnF_GATA 473..517 CDD:238123 20/48 (42%)
ZnF_GATA 529..578 CDD:214648 3/14 (21%)
ZnF_GATA 533..583 CDD:238123 2/10 (20%)
ZIMNP_001190821.1 TIFY 77..112 CDD:198047
CCT 146..189 CDD:399306 4/10 (40%)
ZnF_GATA 209..261 CDD:214648 22/56 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.