DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and AT4G16141

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_680707.4 Gene:AT4G16141 / 827301 AraportID:AT4G16141 Length:197 Species:Arabidopsis thaliana


Alignment Length:134 Identity:38/134 - (28%)
Similarity:44/134 - (32%) Gaps:49/134 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 GSMSGNSGGAGSLSGHSGAGSNAGSNCLDVKPVRTKPRTSAEGRECVNCGATSTPLWRRDGTG-H 492
            |..|....|..|.||..|          |.|            :.||:||.:.|||||....| .
plant    16 GDSSDVDNGNCSSSGSGG----------DTK------------KTCVDCGTSRTPLWRGGPAGPK 58

  Fly   493 YLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAK-------RAGTSCANCKTTTTTLWRRNAS 550
            .||||||:          ..:.||:..|...|...|       ..|....|.||         ..
plant    59 SLCNACGI----------KSRKKRQAALGIRQDDIKIKSKSNNNLGLESRNVKT---------GK 104

  Fly   551 GEPV 554
            ||||
plant   105 GEPV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 17/47 (36%)
ZnF_GATA 473..517 CDD:238123 17/44 (39%)
ZnF_GATA 529..578 CDD:214648 8/26 (31%)
ZnF_GATA 533..583 CDD:238123 7/22 (32%)
AT4G16141NP_680707.4 GATA 39..73 CDD:395253 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X385
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.